Human SELL/CD62L/LAM1 ORF/cDNA clone-Lentivirus particle (NM_000655)

Cat. No.: vGMLP001565

Pre-made Human SELL/CD62L/LAM1 Lentiviral expression plasmid for SELL lentivirus packaging, SELL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SELL/CD62L products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001565 Human SELL Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001565
Gene Name SELL
Accession Number NM_000655
Gene ID 6402
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1158 bp
Gene Alias CD62L,LAM1,LECAM1,LEU8,LNHR,LSEL,LYAM1,PLNHR,TQ1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGATATTTCCATGGAAATGTCAGAGCACCCAGAGGGACTTATGGAACATCTTCAAGTTGTGGGGGTGGACAATGCTCTGTTGTGATTTCCTGGCACATCATGGAACCGACTGCTGGACTTACCATTATTCTGAAAAACCCATGAACTGGCAAAGGGCTAGAAGATTCTGCCGAGACAATTACACAGATTTAGTTGCCATACAAAACAAGGCGGAAATTGAGTATCTGGAGAAGACTCTGCCTTTCAGTCGTTCTTACTACTGGATAGGAATCCGGAAGATAGGAGGAATATGGACGTGGGTGGGAACCAACAAATCTCTTACTGAAGAAGCAGAGAACTGGGGAGATGGTGAGCCCAACAACAAGAAGAACAAGGAGGACTGCGTGGAGATCTATATCAAGAGAAACAAAGATGCAGGCAAATGGAACGATGACGCCTGCCACAAACTAAAGGCAGCCCTCTGTTACACAGCTTCTTGCCAGCCCTGGTCATGCAGTGGCCATGGAGAATGTGTAGAAATCATCAATAATTACACCTGCAACTGTGATGTGGGGTACTATGGGCCCCAGTGTCAGTTTGTGATTCAGTGTGAGCCTTTGGAGGCCCCAGAGCTGGGTACCATGGACTGTACTCACCCTTTGGGAAACTTCAGCTTCAGCTCACAGTGTGCCTTCAGCTGCTCTGAAGGAACAAACTTAACTGGGATTGAAGAAACCACCTGTGGACCATTTGGAAACTGGTCATCTCCAGAACCAACCTGTCAAGTGATTCAGTGTGAGCCTCTATCAGCACCAGATTTGGGGATCATGAACTGTAGCCATCCCCTGGCCAGCTTCAGCTTTACCTCTGCATGTACCTTCATCTGCTCAGAAGGAACTGAGTTAATTGGGAAGAAGAAAACCATTTGTGAATCATCTGGAATCTGGTCAAATCCTAGTCCAATATGTCAAAAATTGGACAAAAGTTTCTCAATGATTAAGGAGGGTGATTATAACCCCCTCTTCATTCCAGTGGCAGTCATGGTTACTGCATTCTCTGGGTTGGCATTTATCATTTGGCTGGCAAGGAGATTAAAAAAAGGCAAGAAATCCAAGAGAAGTATGAATGACCCATATTAA
ORF Protein Sequence MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-INN-739 Pre-Made Aselizumab Biosimilar, Whole Mab, Anti-Sell Antibody: Anti-CD62L/LAM1/LECAM1/LEU8/LNHR/LSEL/LYAM1/PLNHR/TQ1 therapeutic antibody
    Target Antibody GM-Tg-g-T60526-Ab Anti-LYAM1/ SELL/ CD62L monoclonal antibody
    Target Antigen GM-Tg-g-T60526-Ag SELL VLP (virus-like particle)
    ORF Viral Vector pGMLP001565 Human SELL Lentivirus plasmid
    ORF Viral Vector pGMLV002667 Human SELL Lentivirus plasmid
    ORF Viral Vector vGMLP001565 Human SELL Lentivirus particle
    ORF Viral Vector vGMLV002667 Human SELL Lentivirus particle


    Target information

    Target ID GM-T60526
    Target Name SELL
    Gene ID 6402, 20343, 701419, 29259, 100037404, 480080, 281485, 100058663
    Gene Symbol and Synonyms A.11,CD62L,L-selectin,LAM-1,LAM1,LECAM-1,LECAM1,LEU8,LNHR,LSEL,Ly-22,Ly-m22,Lyam-1,LYAM1,PLNHR,SELL,TQ1
    Uniprot Accession P14151
    Uniprot Entry Name LYAM1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, INN Index
    Disease Breast Cancer, Hodgkin's disease
    Gene Ensembl ENSG00000188404
    Target Classification Not Available

    This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.