Human SELL/CD62L/LAM1 ORF/cDNA clone-Lentivirus particle (NM_000655.5)
Cat. No.: vGMLV002667
Pre-made Human SELL/CD62L/LAM1 Lentiviral expression plasmid for SELL lentivirus packaging, SELL lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
SELL/CD62L products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLV002667 | Human SELL Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLV002667 |
Gene Name | SELL |
Accession Number | NM_000655.5 |
Gene ID | 6402 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 1119 bp |
Gene Alias | CD62L,LAM1,LECAM1,LEU8,LNHR,LSEL,LYAM1,PLNHR,TQ1 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGATATTTCCATGGAAATGTCAGAGCACCCAGAGGGACTTATGGAACATCTTCAAGTTGTGGGGGTGGACAATGCTCTGTTGTGATTTCCTGGCACATCATGGAACCGACTGCTGGACTTACCATTATTCTGAAAAACCCATGAACTGGCAAAGGGCTAGAAGATTCTGCCGAGACAATTACACAGATTTAGTTGCCATACAAAACAAGGCGGAAATTGAGTATCTGGAGAAGACTCTGCCTTTCAGTCGTTCTTACTACTGGATAGGAATCCGGAAGATAGGAGGAATATGGACGTGGGTGGGAACCAACAAATCTCTTACTGAAGAAGCAGAGAACTGGGGAGATGGTGAGCCCAACAACAAGAAGAACAAGGAGGACTGCGTGGAGATCTATATCAAGAGAAACAAAGATGCAGGCAAATGGAACGATGACGCCTGCCACAAACTAAAGGCAGCCCTCTGTTACACAGCTTCTTGCCAGCCCTGGTCATGCAGTGGCCATGGAGAATGTGTAGAAATCATCAATAATTACACCTGCAACTGTGATGTGGGGTACTATGGGCCCCAGTGTCAGTTTGTGATTCAGTGTGAGCCTTTGGAGGCCCCAGAGCTGGGTACCATGGACTGTACTCACCCTTTGGGAAACTTCAGCTTCAGCTCACAGTGTGCCTTCAGCTGCTCTGAAGGAACAAACTTAACTGGGATTGAAGAAACCACCTGTGGACCATTTGGAAACTGGTCATCTCCAGAACCAACCTGTCAAGTGATTCAGTGTGAGCCTCTATCAGCACCAGATTTGGGGATCATGAACTGTAGCCATCCCCTGGCCAGCTTCAGCTTTACCTCTGCATGTACCTTCATCTGCTCAGAAGGAACTGAGTTAATTGGGAAGAAGAAAACCATTTGTGAATCATCTGGAATCTGGTCAAATCCTAGTCCAATATGTCAAAAATTGGACAAAAGTTTCTCAATGATTAAGGAGGGTGATTATAACCCCCTCTTCATTCCAGTGGCAGTCATGGTTACTGCATTCTCTGGGTTGGCATTTATCATTTGGCTGGCAAGGAGATTAAAAAAAGGCAAGAAATCCAAGAGAAGTATGAATGACCCATATTAA |
ORF Protein Sequence | MIFPWKCQSTQRDLWNIFKLWGWTMLCCDFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFSSQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEPLSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTICESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVTAFSGLAFIIWLARRLKKGKKSKRSMNDPY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Biosimilar | GMP-Bios-INN-739 | Pre-Made Aselizumab Biosimilar, Whole Mab, Anti-Sell Antibody: Anti-CD62L/LAM1/LECAM1/LEU8/LNHR/LSEL/LYAM1/PLNHR/TQ1 therapeutic antibody |
Target Antibody | GM-Tg-g-T60526-Ab | Anti-LYAM1/ SELL/ CD62L monoclonal antibody |
Target Antigen | GM-Tg-g-T60526-Ag | SELL VLP (virus-like particle) |
ORF Viral Vector | pGMLP001565 | Human SELL Lentivirus plasmid |
ORF Viral Vector | pGMLV002667 | Human SELL Lentivirus plasmid |
ORF Viral Vector | vGMLP001565 | Human SELL Lentivirus particle |
ORF Viral Vector | vGMLV002667 | Human SELL Lentivirus particle |
Target information
Target ID | GM-T60526 |
Target Name | SELL |
Gene ID | 6402, 20343, 701419, 29259, 100037404, 480080, 281485, 100058663 |
Gene Symbol and Synonyms | A.11,CD62L,L-selectin,LAM-1,LAM1,LECAM-1,LECAM1,LEU8,LNHR,LSEL,Ly-22,Ly-m22,Lyam-1,LYAM1,PLNHR,SELL,TQ1 |
Uniprot Accession | P14151 |
Uniprot Entry Name | LYAM1_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Therapeutics Target, INN Index |
Disease | Breast Cancer, Hodgkin's disease |
Gene Ensembl | ENSG00000188404 |
Target Classification | Not Available |
This gene encodes a cell surface adhesion molecule that belongs to a family of adhesion/homing receptors. The encoded protein contains a C-type lectin-like domain, a calcium-binding epidermal growth factor-like domain, and two short complement-like repeats. The gene product is required for binding and subsequent rolling of leucocytes on endothelial cells, facilitating their migration into secondary lymphoid organs and inflammation sites. Single-nucleotide polymorphisms in this gene have been associated with various diseases including immunoglobulin A nephropathy. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Oct 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.