Human PIRT ORF/cDNA clone-Lentivirus particle (NM_001101387)
Cat. No.: vGMLP001830
Pre-made Human PIRT/ Lentiviral expression plasmid for PIRT lentivirus packaging, PIRT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PIRT/ products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP001830 | Human PIRT Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP001830 |
Gene Name | PIRT |
Accession Number | NM_001101387 |
Gene ID | 644139 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 414 bp |
Gene Alias | |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACGATGGAGACTCTCCCCAAGGTTCTAGAGGTCGATGAGAAGTCTCCAGAAGCCAAGGACCTGCTGCCCAGCCAGACCGCCAGCTCCCTGTGCATCAGCTCCAGGAGCGAGTCTGTCTGGACCACCACCCCCAGGAGTAACTGGGAAATCTACCGCAAGCCCATCGTTATCATGTCAGTGGGCGGTGCCATCCTGCTTTTCGGCGTGGTCATCACCTGCTTGGCCTACACCTTGAAGCTGAGTGACAAGAGTCTCTCCATCCTCAAAATGGTAGGGCCTGGCTTCCTGTCCCTGGGACTCATGATGCTGGTGTGCGGGCTGGTGTGGGTGCCCATCATCAAAAAGAAACAGAAGCACAGACAGAAGTCGAATTTCTTACGCAGCCTCAAGTCCTTCTTCCTGACTCGCTGA |
ORF Protein Sequence | MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQKSNFLRSLKSFFLTR |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP1373-Ab | Anti-PIRT monoclonal antibody |
Target Antigen | GM-Tg-g-MP1373-Ag | PIRT VLP (virus-like particle) |
ORF Viral Vector | pGMLP001830 | Human PIRT Lentivirus plasmid |
ORF Viral Vector | vGMLP001830 | Human PIRT Lentivirus particle |
Target information
Target ID | GM-MP1373 |
Target Name | PIRT |
Gene ID | 644139, 193003, 722083, 497929, 101085672, 100686498, 100140752, 100063035 |
Gene Symbol and Synonyms | A530088H08Rik,PIRT,RGD1565284 |
Uniprot Accession | P0C851 |
Uniprot Entry Name | PIRT_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000233670 |
Target Classification | Not Available |
Predicted to enable phosphatidylinositol bisphosphate binding activity and transmembrane transporter binding activity. Predicted to be involved in phosphatidylinositol-mediated signaling and positive regulation of cation channel activity. Predicted to act upstream of or within behavioral response to pain and response to heat. Predicted to be integral component of membrane. Predicted to be active in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.