Human PIRT ORF/cDNA clone-Lentivirus particle (NM_001101387)

Cat. No.: vGMLP001830

Pre-made Human PIRT/ Lentiviral expression plasmid for PIRT lentivirus packaging, PIRT lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PIRT/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001830 Human PIRT Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001830
Gene Name PIRT
Accession Number NM_001101387
Gene ID 644139
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 414 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACGATGGAGACTCTCCCCAAGGTTCTAGAGGTCGATGAGAAGTCTCCAGAAGCCAAGGACCTGCTGCCCAGCCAGACCGCCAGCTCCCTGTGCATCAGCTCCAGGAGCGAGTCTGTCTGGACCACCACCCCCAGGAGTAACTGGGAAATCTACCGCAAGCCCATCGTTATCATGTCAGTGGGCGGTGCCATCCTGCTTTTCGGCGTGGTCATCACCTGCTTGGCCTACACCTTGAAGCTGAGTGACAAGAGTCTCTCCATCCTCAAAATGGTAGGGCCTGGCTTCCTGTCCCTGGGACTCATGATGCTGGTGTGCGGGCTGGTGTGGGTGCCCATCATCAAAAAGAAACAGAAGCACAGACAGAAGTCGAATTTCTTACGCAGCCTCAAGTCCTTCTTCCTGACTCGCTGA
ORF Protein Sequence MTMETLPKVLEVDEKSPEAKDLLPSQTASSLCISSRSESVWTTTPRSNWEIYRKPIVIMSVGGAILLFGVVITCLAYTLKLSDKSLSILKMVGPGFLSLGLMMLVCGLVWVPIIKKKQKHRQKSNFLRSLKSFFLTR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1373-Ab Anti-PIRT monoclonal antibody
    Target Antigen GM-Tg-g-MP1373-Ag PIRT VLP (virus-like particle)
    ORF Viral Vector pGMLP001830 Human PIRT Lentivirus plasmid
    ORF Viral Vector vGMLP001830 Human PIRT Lentivirus particle


    Target information

    Target ID GM-MP1373
    Target Name PIRT
    Gene ID 644139, 193003, 722083, 497929, 101085672, 100686498, 100140752, 100063035
    Gene Symbol and Synonyms A530088H08Rik,PIRT,RGD1565284
    Uniprot Accession P0C851
    Uniprot Entry Name PIRT_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000233670
    Target Classification Not Available

    Predicted to enable phosphatidylinositol bisphosphate binding activity and transmembrane transporter binding activity. Predicted to be involved in phosphatidylinositol-mediated signaling and positive regulation of cation channel activity. Predicted to act upstream of or within behavioral response to pain and response to heat. Predicted to be integral component of membrane. Predicted to be active in plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.