Human IFITM5/BRIL/DSPA1 ORF/cDNA clone-Lentivirus particle (NM_001025295)

Cat. No.: vGMLP001871

Pre-made Human IFITM5/BRIL/DSPA1 Lentiviral expression plasmid for IFITM5 lentivirus packaging, IFITM5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to IFITM5/BRIL products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP001871 Human IFITM5 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP001871
Gene Name IFITM5
Accession Number NM_001025295
Gene ID 387733
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 399 bp
Gene Alias BRIL,DSPA1,fragilis4,Hrmp1,OI5
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGACACGGCGTATCCCCGCGAGGACACCCGGGCCCCCACGCCCAGCAAGGCCGGTGCCCACACAGCCCTCACACTGGGGGCCCCGCACCCCCCGCCTCGAGACCACTTGATCTGGTCGGTGTTCAGCACCCTCTACCTGAATCTGTGTTGCCTCGGCTTCCTGGCGCTGGCCTACTCCATCAAGGCCCGAGATCAGAAGGTGGTTGGTGACCTGGAAGCGGCCCGGCGTTTTGGCTCCAAAGCCAAGTGCTACAACATCCTGGCCGCGATGTGGACGCTGGTGCCGCCACTGCTGCTCCTGGGGCTGGTGGTGACTGGTGCCCTGCACCTGGCCCGGCTGGCCAAGGACTCTGCCGCCTTCTTCAGCACCAAGTTTGATGACGCGGACTATGACTGA
ORF Protein Sequence MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0606-Ab Anti-IFM5/ IFITM5/ BRIL monoclonal antibody
    Target Antigen GM-Tg-g-MP0606-Ag IFITM5 VLP (virus-like particle)
    ORF Viral Vector pGMLP000848 Human IFITM5 Lentivirus plasmid
    ORF Viral Vector pGMLP001871 Human IFITM5 Lentivirus plasmid
    ORF Viral Vector vGMLP000848 Human IFITM5 Lentivirus particle
    ORF Viral Vector vGMLP001871 Human IFITM5 Lentivirus particle


    Target information

    Target ID GM-MP0606
    Target Name IFITM5
    Gene ID 387733, 73835, 697314, 293617, 101101083, 119864192, 526461, 100050873
    Gene Symbol and Synonyms 1110003J06Rik,BRIL,DSPA1,fragilis4,Hrmp1,Hrtm1,IFITM5,OI5
    Uniprot Accession A6NNB3
    Uniprot Entry Name IFM5_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000206013
    Target Classification Not Available

    This gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V (PMID: 22863190, 22863195). [provided by RefSeq, Aug 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.