Human IFITM5/BRIL/DSPA1 ORF/cDNA clone-Lentivirus particle (NM_001025295)
Cat. No.: vGMLP001871
Pre-made Human IFITM5/BRIL/DSPA1 Lentiviral expression plasmid for IFITM5 lentivirus packaging, IFITM5 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IFITM5/BRIL products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP001871 | Human IFITM5 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP001871 |
Gene Name | IFITM5 |
Accession Number | NM_001025295 |
Gene ID | 387733 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 399 bp |
Gene Alias | BRIL,DSPA1,fragilis4,Hrmp1,OI5 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGACACGGCGTATCCCCGCGAGGACACCCGGGCCCCCACGCCCAGCAAGGCCGGTGCCCACACAGCCCTCACACTGGGGGCCCCGCACCCCCCGCCTCGAGACCACTTGATCTGGTCGGTGTTCAGCACCCTCTACCTGAATCTGTGTTGCCTCGGCTTCCTGGCGCTGGCCTACTCCATCAAGGCCCGAGATCAGAAGGTGGTTGGTGACCTGGAAGCGGCCCGGCGTTTTGGCTCCAAAGCCAAGTGCTACAACATCCTGGCCGCGATGTGGACGCTGGTGCCGCCACTGCTGCTCCTGGGGCTGGTGGTGACTGGTGCCCTGCACCTGGCCCGGCTGGCCAAGGACTCTGCCGCCTTCTTCAGCACCAAGTTTGATGACGCGGACTATGACTGA |
ORF Protein Sequence | MDTAYPREDTRAPTPSKAGAHTALTLGAPHPPPRDHLIWSVFSTLYLNLCCLGFLALAYSIKARDQKVVGDLEAARRFGSKAKCYNILAAMWTLVPPLLLLGLVVTGALHLARLAKDSAAFFSTKFDDADYD |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP0606-Ab | Anti-IFM5/ IFITM5/ BRIL monoclonal antibody |
Target Antigen | GM-Tg-g-MP0606-Ag | IFITM5 VLP (virus-like particle) |
ORF Viral Vector | pGMLP000848 | Human IFITM5 Lentivirus plasmid |
ORF Viral Vector | pGMLP001871 | Human IFITM5 Lentivirus plasmid |
ORF Viral Vector | vGMLP000848 | Human IFITM5 Lentivirus particle |
ORF Viral Vector | vGMLP001871 | Human IFITM5 Lentivirus particle |
Target information
Target ID | GM-MP0606 |
Target Name | IFITM5 |
Gene ID | 387733, 73835, 697314, 293617, 101101083, 119864192, 526461, 100050873 |
Gene Symbol and Synonyms | 1110003J06Rik,BRIL,DSPA1,fragilis4,Hrmp1,Hrtm1,IFITM5,OI5 |
Uniprot Accession | A6NNB3 |
Uniprot Entry Name | IFM5_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000206013 |
Target Classification | Not Available |
This gene encodes a membrane protein thought to play a role in bone mineralization. This gene is located on chromosome 11 in a cluster of related genes which are induced by interferon, however, this gene has not been shown to be interferon inducible. A similar gene, located in a gene cluster on mouse chromosome 7, is a member of the interferon-inducible fragilis gene family. The mouse gene encodes a transmembrane protein described as participating in germ cell competence. A mutation in the 5' UTR of this gene has been associated with osteogenesis imperfecta type V (PMID: 22863190, 22863195). [provided by RefSeq, Aug 2012]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.