Human B4GALNT1/GALGT/GalNAc-T ORF/cDNA clone-Lentivirus particle (NM_001276469)

Cat. No.: vGMLP002718

Pre-made Human B4GALNT1/GALGT/GalNAc-T Lentiviral expression plasmid for B4GALNT1 lentivirus packaging, B4GALNT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to B4GALNT1/GALGT products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002718 Human B4GALNT1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002718
Gene Name B4GALNT1
Accession Number NM_001276469
Gene ID 2583
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 987 bp
Gene Alias GALGT,GalNAc-T,GALNACT,SPG26
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGCTGGGCCGCCGGGCCCTGTGCGCTCTGGTCCTTCTGCTCGCCTGCGCCTCGCTGGGGCTCCTGTACGCGAGCACCCGGGACGCGCCCGGCCTCCGGCTACCTCTTGCGCCGTGGGCGCCCCCGCAAAGCCCCCGCAGGCCCGAGCTGCCAGATCTTGCTCCTGAGCCCCGCTACGCACACATCCCGGTCAGGATCAAGGAGCAAGTAGTGGGGCTGCTGGCTTGGAACAACTGCAGTTGTGAGTCCAGTGGGGGGGGCCTCCCCCTCCCCTTCCAGAAACAAGTCCGAGCTATTGACCTCACCAAGGCCTTTGACCCTGCAGAGCTGAGGGCTGCCTCTGCCACAAGAGAGCAGGAGTTCCAGGCCTTTCTGTCGAGGAGCCAGTCCCCAGCTGACCAGCTGCTCATAGCCCCTGCCAACTCCCCGCTCCAGTACCCCCTACAGGGTGTGGAAGTTCAGCCCCTCAGGAGCATCTTGGTGCCAGGGCTGAGCCTTCAGGCAGCTTCTGGTCAGGAGGTATACCAGGTGAACCTGACTGCCTCCCTAGGCACCTGGGACGTGGCAGGGGAAGTGACTGGAGTTACTCTCACTGGAGAGGGTCAGGCAGATCTCACCCTTGTCAGCCCAGGGCTGGACCAACTCAACAGGCAACTACAACTGGTCACTTACAGCAGCCGAAGCTACCAGACCAACACAGCAGACACAGGTGCAAGGCCTGGGTGGAGAGACGGGCAGGCTGGGCAAACAGAGAAGAACCAGAAAGGCTGGAGTGGGCAAATGGCAGAGGGCATGGGAGGCATCTGGGCTATGGCCAGAGCTGTCCAGCCACACAATGGGTGCTTCAACTGGACCAGCAGGGCCAGAGGGAGAAAGGGGGCCTTTGTTCATCTGGGGCTGGAGCAGGCCAGAGGGAAACCCGAGCCTTGGGTGTGTCTCCCCTTTAGGCCAACTGTGGGGGGCCCCAGGAAGAGACTTGTCTAA
ORF Protein Sequence MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0128-Ab Anti-B4GN1/ B4GALNT1/ GALGT monoclonal antibody
    Target Antigen GM-Tg-g-MP0128-Ag B4GALNT1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002718 Human B4GALNT1 Lentivirus plasmid
    ORF Viral Vector vGMLP002718 Human B4GALNT1 Lentivirus particle


    Target information

    Target ID GM-MP0128
    Target Name B4GALNT1
    Gene ID 2583, 14421, 715317, 64828, 101082581, 481129, 520159, 100053616
    Gene Symbol and Synonyms 4933429D13Rik,B4GALNT1,Gal-NAc-T,GALGT,Galgt1,GalNAc-T,GALNACT,Ggm-2,Ggm2,SPG26
    Uniprot Accession Q00973
    Uniprot Entry Name B4GN1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000135454
    Target Classification Not Available

    GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.