Human B4GALNT1/GALGT/GalNAc-T ORF/cDNA clone-Lentivirus particle (NM_001276469)
Cat. No.: vGMLP002718
Pre-made Human B4GALNT1/GALGT/GalNAc-T Lentiviral expression plasmid for B4GALNT1 lentivirus packaging, B4GALNT1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
B4GALNT1/GALGT products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP002718 | Human B4GALNT1 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP002718 |
| Gene Name | B4GALNT1 |
| Accession Number | NM_001276469 |
| Gene ID | 2583 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 987 bp |
| Gene Alias | GALGT,GalNAc-T,GALNACT,SPG26 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGGCTGGGCCGCCGGGCCCTGTGCGCTCTGGTCCTTCTGCTCGCCTGCGCCTCGCTGGGGCTCCTGTACGCGAGCACCCGGGACGCGCCCGGCCTCCGGCTACCTCTTGCGCCGTGGGCGCCCCCGCAAAGCCCCCGCAGGCCCGAGCTGCCAGATCTTGCTCCTGAGCCCCGCTACGCACACATCCCGGTCAGGATCAAGGAGCAAGTAGTGGGGCTGCTGGCTTGGAACAACTGCAGTTGTGAGTCCAGTGGGGGGGGCCTCCCCCTCCCCTTCCAGAAACAAGTCCGAGCTATTGACCTCACCAAGGCCTTTGACCCTGCAGAGCTGAGGGCTGCCTCTGCCACAAGAGAGCAGGAGTTCCAGGCCTTTCTGTCGAGGAGCCAGTCCCCAGCTGACCAGCTGCTCATAGCCCCTGCCAACTCCCCGCTCCAGTACCCCCTACAGGGTGTGGAAGTTCAGCCCCTCAGGAGCATCTTGGTGCCAGGGCTGAGCCTTCAGGCAGCTTCTGGTCAGGAGGTATACCAGGTGAACCTGACTGCCTCCCTAGGCACCTGGGACGTGGCAGGGGAAGTGACTGGAGTTACTCTCACTGGAGAGGGTCAGGCAGATCTCACCCTTGTCAGCCCAGGGCTGGACCAACTCAACAGGCAACTACAACTGGTCACTTACAGCAGCCGAAGCTACCAGACCAACACAGCAGACACAGGTGCAAGGCCTGGGTGGAGAGACGGGCAGGCTGGGCAAACAGAGAAGAACCAGAAAGGCTGGAGTGGGCAAATGGCAGAGGGCATGGGAGGCATCTGGGCTATGGCCAGAGCTGTCCAGCCACACAATGGGTGCTTCAACTGGACCAGCAGGGCCAGAGGGAGAAAGGGGGCCTTTGTTCATCTGGGGCTGGAGCAGGCCAGAGGGAAACCCGAGCCTTGGGTGTGTCTCCCCTTTAGGCCAACTGTGGGGGGCCCCAGGAAGAGACTTGTCTAA |
| ORF Protein Sequence | MWLGRRALCALVLLLACASLGLLYASTRDAPGLRLPLAPWAPPQSPRRPELPDLAPEPRYAHIPVRIKEQVVGLLAWNNCSCESSGGGLPLPFQKQVRAIDLTKAFDPAELRAASATREQEFQAFLSRSQSPADQLLIAPANSPLQYPLQGVEVQPLRSILVPGLSLQAASGQEVYQVNLTASLGTWDVAGEVTGVTLTGEGQADLTLVSPGLDQLNRQLQLVTYSSRSYQTNTADTGARPGWRDGQAGQTEKNQKGWSGQMAEGMGGIWAMARAVQPHNGCFNWTSRARGRKGAFVHLGLEQARGKPEPWVCLPFRPTVGGPRKRLV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP0128-Ab | Anti-B4GN1/ B4GALNT1/ GALGT monoclonal antibody |
| Target Antigen | GM-Tg-g-MP0128-Ag | B4GALNT1 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP002718 | Human B4GALNT1 Lentivirus plasmid |
| ORF Viral Vector | vGMLP002718 | Human B4GALNT1 Lentivirus particle |
Target information
| Target ID | GM-MP0128 |
| Target Name | B4GALNT1 |
| Gene ID | 2583, 14421, 715317, 64828, 101082581, 481129, 520159, 100053616 |
| Gene Symbol and Synonyms | 4933429D13Rik,B4GALNT1,Gal-NAc-T,GALGT,Galgt1,GalNAc-T,GALNACT,Ggm-2,Ggm2,SPG26 |
| Uniprot Accession | Q00973 |
| Uniprot Entry Name | B4GN1_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000135454 |
| Target Classification | Not Available |
GM2 and GD2 gangliosides are sialic acid-containing glycosphingolipids. GalNAc-T is the enzyme involved in the biosynthesis of G(M2) and G(D2) glycosphingolipids. GalNAc-T catalyzes the transfer of GalNAc into G(M3) and G(D3) by a beta-1,4 linkage, resulting in the synthesis of G(M2) and G(D2), respectively. Three transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2013]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


