Human SCN1B/ATFB13/BRGDA5 ORF/cDNA clone-Lentivirus particle (NM_199037)

Cat. No.: vGMLP002937

Pre-made Human SCN1B/ATFB13/BRGDA5 Lentiviral expression plasmid for SCN1B lentivirus packaging, SCN1B lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SCN1B/ATFB13 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP002937 Human SCN1B Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP002937
Gene Name SCN1B
Accession Number NM_199037
Gene ID 6324
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 807 bp
Gene Alias ATFB13,BRGDA5,EIEE52,GEFSP1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGAGGCTGCTGGCCTTAGTGGTCGGCGCGGCACTGGTGTCCTCAGCCTGCGGGGGCTGCGTGGAGGTGGACTCGGAGACCGAGGCCGTGTATGGGATGACCTTCAAAATTCTTTGCATCTCCTGCAAGCGCCGCAGCGAGACCAACGCTGAGACCTTCACCGAGTGGACCTTCCGCCAGAAGGGCACTGAGGAGTTTGTCAAGATCCTGCGCTATGAGAATGAGGTGTTGCAGCTGGAGGAGGATGAGCGCTTCGAGGGCCGCGTGGTGTGGAATGGCAGCCGGGGCACCAAAGACCTGCAGGATCTGTCTATCTTCATCACCAATGTCACCTACAACCACTCGGGCGACTACGAGTGCCACGTCTACCGCCTGCTCTTCTTCGAAAACTACGAGCACAACACCAGCGTCGTCAAGAAGATCCACATTGAGGTAGTGGACAAAGGTGAGTCGGGTGCTGCCTGCCCCTTTACCGTCACCCACCGGAGAGCCAGATGGAGGGACAGATGGCAGGCAGTGGACAGGACAGGCTGGCTCTGTGCCTGGCCAGCCAACCGCCCACAGCAGCGGGCTGAGGGGGAGGGGAGCAGCCCCTCCTGCCCACTCCAGCTCTGGCCTCTGTTTCTCTCCAGCCCACGGAGAGGTCAAAGCATGCCTGTCCCCCACAGACGCTCCGGGTACAGAACCCAGCTCTGTCACCTGTGCTGTATGACCTCTGGCAGGTGCCTTCTGTCTCTGAGCCAAAGGGTTGTCCTGGGCTTGCCCGGGATAATAATCCGATGTGTTTCTCGGGGTGTGGTTTGA
ORF Protein Sequence MGRLLALVVGAALVSSACGGCVEVDSETEAVYGMTFKILCISCKRRSETNAETFTEWTFRQKGTEEFVKILRYENEVLQLEEDERFEGRVVWNGSRGTKDLQDLSIFITNVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKGESGAACPFTVTHRRARWRDRWQAVDRTGWLCAWPANRPQQRAEGEGSSPSCPLQLWPLFLSSPRRGQSMPVPHRRSGYRTQLCHLCCMTSGRCLLSLSQRVVLGLPGIIIRCVSRGVV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1487-Ab Anti-SCN1B/ ATFB13/ BRGDA5 monoclonal antibody
    Target Antigen GM-Tg-g-MP1487-Ag SCN1B VLP (virus-like particle)
    ORF Viral Vector pGMLP002937 Human SCN1B Lentivirus plasmid
    ORF Viral Vector vGMLP002937 Human SCN1B Lentivirus particle


    Target information

    Target ID GM-MP1487
    Target Name SCN1B
    Gene ID 6324, 20266, 707134, 29686, 101101526, 484584, 618204, 100050415
    Gene Symbol and Synonyms ATFB13,BRGDA5,DEE52,EIEE52,GEFSP1,SCN1B
    Uniprot Accession Q07699
    Uniprot Entry Name SCN1B_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000105711
    Target Classification Not Available

    Voltage-gated sodium channels are heteromeric proteins that function in the generation and propagation of action potentials in muscle and neuronal cells. They are composed of one alpha and two beta subunits, where the alpha subunit provides channel activity and the beta-1 subunit modulates the kinetics of channel inactivation. This gene encodes a sodium channel beta-1 subunit. Mutations in this gene result in generalized epilepsy with febrile seizures plus, Brugada syndrome 5, and defects in cardiac conduction. Multiple transcript variants encoding different isoforms have been found for this gene.[provided by RefSeq, Oct 2009]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.