Human TMEM88 ORF/cDNA clone-Lentivirus particle (NM_203411)

Cat. No.: vGMLP004181

Pre-made Human TMEM88/ Lentiviral expression plasmid for TMEM88 lentivirus packaging, TMEM88 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM88/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004181 Human TMEM88 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004181
Gene Name TMEM88
Accession Number NM_203411
Gene ID 92162
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 480 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGATGTCCCCGGGGCACAGCGAGCGGTTCCTGGTGACGGCCCAGAGCCCCGGGACCCCCTGGACTGTTGGGCCTGCGCTGTTCTTGTAACAGCCCAGAATCTGCTGGTGGCTGCCTTCAATCTTCTCCTGCTGGTGCTGGTGCTAGGGACCATCTTGCTACCCGCTGTCACCATGCTGGGCTTCGGCTTCCTCTGCCACTCTCAGTTCCTGCGCTCCCAGGCACCCCCTTGCACCGCGCACCTGCGGGACCCCGGTTTCACGGCCCTACTGGTCACCGGATTCCTGCTCCTCGTGCCGCTGCTCGTGCTTGCTCTGGCCAGCTACCGCCGCCTCTGCCTGCGCCTCCGCCTAGCCGATTGCCTCGTGCCCTACAGCCGAGCCCTTTATCGGCGTCGGCGCGCCCCGCAGCCGCGGCAAATCCGGGCCTCACCAGGGTCCCAGGCCGTTCCCACATCAGGAAAGGTCTGGGTCTAA
ORF Protein Sequence MADVPGAQRAVPGDGPEPRDPLDCWACAVLVTAQNLLVAAFNLLLLVLVLGTILLPAVTMLGFGFLCHSQFLRSQAPPCTAHLRDPGFTALLVTGFLLLVPLLVLALASYRRLCLRLRLADCLVPYSRALYRRRRAPQPRQIRASPGSQAVPTSGKVWV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1841-Ab Anti-TMM88/ TMEM88 monoclonal antibody
    Target Antigen GM-Tg-g-MP1841-Ag TMEM88 VLP (virus-like particle)
    ORF Viral Vector pGMLP004181 Human TMEM88 Lentivirus plasmid
    ORF Viral Vector vGMLP004181 Human TMEM88 Lentivirus particle


    Target information

    Target ID GM-MP1841
    Target Name TMEM88
    Gene ID 92162, 67020, 716381, 497936, 102899448, 607946, 507172, 100062112
    Gene Symbol and Synonyms 2600017H02Rik,RGD1561781,TMEM88
    Uniprot Accession Q6PEY1
    Uniprot Entry Name TMM88_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000167874
    Target Classification Not Available

    Predicted to enable PDZ domain binding activity. Involved in negative regulation of canonical Wnt signaling pathway; protein localization to plasma membrane; and protein stabilization. Located in cytosol and plasma membrane. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.