Human ICOS/AILIM/CD278 ORF/cDNA clone-Lentivirus particle (NM_012092)

Cat. No.: vGMLP004459

Pre-made Human ICOS/AILIM/CD278 Lentiviral expression plasmid for ICOS lentivirus packaging, ICOS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ICOS/AILIM products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004459 Human ICOS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004459
Gene Name ICOS
Accession Number NM_012092
Gene ID 29851
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 600 bp
Gene Alias AILIM,CD278,CVID1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAGTCAGGCCTCTGGTATTTCTTTCTCTTCTGCTTGCGCATTAAAGTTTTAACAGGAGAAATCAATGGTTCTGCCAATTATGAGATGTTTATATTTCACAACGGAGGTGTACAAATTTTATGCAAATATCCTGACATTGTCCAGCAATTTAAAATGCAGTTGCTGAAAGGGGGGCAAATACTCTGCGATCTCACTAAGACAAAAGGAAGTGGAAACACAGTGTCCATTAAGAGTCTGAAATTCTGCCATTCTCAGTTATCCAACAACAGTGTCTCTTTTTTTCTATACAACTTGGACCATTCTCATGCCAACTATTACTTCTGCAACCTATCAATTTTTGATCCTCCTCCTTTTAAAGTAACTCTTACAGGAGGATATTTGCATATTTATGAATCACAACTTTGTTGCCAGCTGAAGTTCTGGTTACCCATAGGATGTGCAGCCTTTGTTGTAGTCTGCATTTTGGGATGCATACTTATTTGTTGGCTTACAAAAAAGAAGTATTCATCCAGTGTGCACGACCCTAACGGTGAATACATGTTCATGAGAGCAGTGAACACAGCCAAAAAATCTAGACTCACAGATGTGACCCTATAA
ORF Protein Sequence MKSGLWYFFLFCLRIKVLTGEINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKFWLPIGCAAFVVVCILGCILICWLTKKKYSSSVHDPNGEYMFMRAVNTAKKSRLTDVTL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Biosimilar GMP-Bios-ab-629 Pre-Made Vopratelimab biosimilar, Whole mAb, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-ab-017 Pre-Made Alomfilimab biosimilar, Whole mAb, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-ab-207 Pre-Made Feladilimab biosimilar, Whole mAb, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-ab-499 Pre-Made Rozibafusp biosimilar, Whole mAb Fusion, Anti-ICOS Antibody: Anti-AILIM/CD278/CVID1 therapeutic antibody
    Biosimilar GMP-Bios-INN-982 Pre-Made Rozibafusp Alfa Biosimilar, Fusion Protein targeting ICOS fused with human TNFSF13B (tumor necrosis factor (TNF) superfamily member 13B, BAFF, THANK, TALL1, TALL-1, BLYS, BLyS, B cell activating factor, B lymphocyte activator, CD257): Recombinant therapeutic protein targeting AILIM/CD278/CVID1
    Biosimilar GMP-Bios-ab-287 Pre-Made Izuralimab biosimilar, Bispecific Mixed mAb and scFv, Anti-ICOS;PDCD1/PD-1 antibody: Anti-AILIM/CD278/CVID1;CD279/SLEB2/hPD-1/hPD-l/hSLE1 therapeutic antibody
    Target Antibody GM-Tg-g-T62705-Ab Anti-ICOS/ AILIM/ CD278 monoclonal antibody
    Target Antigen GM-Tg-g-T62705-Ag ICOS VLP (virus-like particle)
    ORF Viral Vector pGMLP004459 Human ICOS Lentivirus plasmid
    ORF Viral Vector vGMLP004459 Human ICOS Lentivirus particle


    Target information

    Target ID GM-T62705
    Target Name ICOS
    Gene ID 29851, 54167, 705788, 64545, 101089031, 403456, 507026, 100067953
    Gene Symbol and Synonyms AILIM,CCLP,CD278,CRP-1,CVID1,H4,ICOS,Ly115
    Uniprot Accession Q9Y6W8
    Uniprot Entry Name ICOS_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Therapeutics Target, Immuno-oncology Target, INN Index
    Disease Not Available
    Gene Ensembl ENSG00000163600
    Target Classification Checkpoint-Immuno Oncology

    The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.