Human IL17C/CX2/IL-17C ORF/cDNA clone-Lentivirus particle (NM_013278)
Cat. No.: vGMLP004492
Pre-made Human IL17C/CX2/IL-17C Lentiviral expression plasmid for IL17C lentivirus packaging, IL17C lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
IL17C/CX2 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004492 | Human IL17C Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004492 |
| Gene Name | IL17C |
| Accession Number | NM_013278 |
| Gene ID | 27189 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 594 bp |
| Gene Alias | CX2,IL-17C |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGACGCTCCTCCCCGGCCTCCTGTTTCTGACCTGGCTGCACACATGCCTGGCCCACCATGACCCCTCCCTCAGGGGGCACCCCCACAGTCACGGTACCCCACACTGCTACTCGGCTGAGGAACTGCCCCTCGGCCAGGCCCCCCCACACCTGCTGGCTCGAGGTGCCAAGTGGGGGCAGGCTTTGCCTGTAGCCCTGGTGTCCAGCCTGGAGGCAGCAAGCCACAGGGGGAGGCACGAGAGGCCCTCAGCTACGACCCAGTGCCCGGTGCTGCGGCCGGAGGAGGTGTTGGAGGCAGACACCCACCAGCGCTCCATCTCACCCTGGAGATACCGTGTGGACACGGATGAGGACCGCTATCCACAGAAGCTGGCCTTCGCCGAGTGCCTGTGCAGAGGCTGTATCGATGCACGGACGGGCCGCGAGACAGCTGCGCTCAACTCCGTGCGGCTGCTCCAGAGCCTGCTGGTGCTGCGCCGCCGGCCCTGCTCCCGCGACGGCTCGGGGCTCCCCACACCTGGGGCCTTTGCCTTCCACACCGAGTTCATCCACGTCCCCGTCGGCTGCACCTGCGTGCTGCCCCGTTCAGTGTGA |
| ORF Protein Sequence | MTLLPGLLFLTWLHTCLAHHDPSLRGHPHSHGTPHCYSAEELPLGQAPPHLLARGAKWGQALPVALVSSLEAASHRGRHERPSATTQCPVLRPEEVLEADTHQRSISPWRYRVDTDEDRYPQKLAFAECLCRGCIDARTGRETAALNSVRLLQSLLVLRRRPCSRDGSGLPTPGAFAFHTEFIHVPVGCTCVLPRSV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE1022-Ab | Anti-IL17C/ CX2/ IL-17C functional antibody |
| Target Antigen | GM-Tg-g-SE1022-Ag | IL17C protein |
| Cytokine | cks-Tg-g-GM-SE1022 | interleukin 17C (IL17C) protein & antibody |
| ORF Viral Vector | pGMLP004492 | Human IL17C Lentivirus plasmid |
| ORF Viral Vector | pGMLP-IL-022 | Human IL17C Lentivirus plasmid |
| ORF Viral Vector | pGMAP-IL-105 | Human IL17C Adenovirus plasmid |
| ORF Viral Vector | vGMLP004492 | Human IL17C Lentivirus particle |
| ORF Viral Vector | vGMLP-IL-022 | Human IL17C Lentivirus particle |
| ORF Viral Vector | vGMAP-IL-105 | Human IL17C Adenovirus particle |
Target information
| Target ID | GM-SE1022 |
| Target Name | IL17C |
| Gene ID | 27189, 234836, 710618, 691516, 101097443, 608988, 100050766 |
| Gene Symbol and Synonyms | CX2,IL-17C,IL17C |
| Uniprot Accession | Q9P0M4 |
| Uniprot Entry Name | IL17C_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Cytokine Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000124391 |
| Target Classification | Tumor-associated antigen (TAA) |
The protein encoded by this gene is a T cell-derived cytokine that shares the sequence similarity with IL17. This cytokine was reported to stimulate the release of tumor necrosis factor alpha and interleukin 1 beta from a monocytic cell line. The expression of this cytokine was found to be restricted to activated T cells. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


