Human GYPE/GPE/MiIX ORF/cDNA clone-Lentivirus particle (NM_002102)

Cat. No.: vGMLP004611

Pre-made Human GYPE/GPE/MiIX Lentiviral expression plasmid for GYPE lentivirus packaging, GYPE lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to GYPE/GPE products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004611 Human GYPE Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004611
Gene Name GYPE
Accession Number NM_002102
Gene ID 2996
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 237 bp
Gene Alias GPE,MiIX,MNS
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTATGGAAAAATAATCTTTGTATTACTATTGTCAGGAATTGTGAGCATATCAGCATCAAGTACCACTGGTGTGGCAATGCACACTTCAACCTCTTCTTCAGTCACAAAGAGTTACATCTCATCACAGACAAATGGGATAACACTCATTAATTGGTGGGCGATGGCTCGTGTTATTTTTGAGGTGATGCTTGTTGTTGTTGGAATGATCATCTTAATTTCTTACTGTATTCGATGA
ORF Protein Sequence MYGKIIFVLLLSGIVSISASSTTGVAMHTSTSSSVTKSYISSQTNGITLINWWAMARVIFEVMLVVVGMIILISYCIR

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP0568-Ab Anti-GLPE/ GYPE/ GPE monoclonal antibody
    Target Antigen GM-Tg-g-MP0568-Ag GYPE VLP (virus-like particle)
    ORF Viral Vector pGMLP004611 Human GYPE Lentivirus plasmid
    ORF Viral Vector vGMLP004611 Human GYPE Lentivirus particle


    Target information

    Target ID GM-MP0568
    Target Name GYPE
    Gene ID 2996
    Gene Symbol and Synonyms GPE,GYPA,GYPE,MiIX,MNS
    Uniprot Accession P15421
    Uniprot Entry Name GLPE_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000197465
    Target Classification Not Available

    The protein encoded by this gene is a sialoglycoprotein and a type I membrane protein. It is a member of a gene family with GPA and GPB genes. This encoded protein might carry the M blood group antigen. GYPA, GYPB, and GYPE are organized in tandem on chromosome 4. This gene might have derived from an ancestral gene common to the GPB gene by gene duplication. Two alternatively spliced transcript variants encoding the same protein have been described for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.