Human CD99/HBA71/MIC2 ORF/cDNA clone-Lentivirus particle (NM_002414)
Cat. No.: vGMLP004612
Pre-made Human CD99/HBA71/MIC2 Lentiviral expression plasmid for CD99 lentivirus packaging, CD99 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
MIC2/CD99/HBA71 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004612 | Human CD99 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004612 |
| Gene Name | CD99 |
| Accession Number | NM_002414 |
| Gene ID | 4267 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 558 bp |
| Gene Alias | HBA71,MIC2,MIC2X,MIC2Y,MSK5X |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCCCGCGGGGCTGCGCTGGCGCTGCTGCTCTTCGGCCTGCTGGGTGTTCTGGTCGCCGCCCCGGATGGTGGTTTCGATTTATCCGATGCCCTTCCTGACAATGAAAACAAGAAACCCACTGCAATCCCCAAGAAACCCAGTGCTGGGGATGACTTTGACTTAGGAGATGCTGTTGTTGATGGAGAAAATGACGACCCACGACCACCGAACCCACCCAAACCGATGCCAAATCCAAACCCCAACCACCCTAGTTCCTCCGGTAGCTTTTCAGATGCTGACCTTGCGGATGGCGTTTCAGGTGGAGAAGGAAAAGGAGGCAGTGATGGTGGAGGCAGCCACAGGAAAGAAGGGGAAGAGGCCGACGCCCCAGGCGTGATCCCCGGGATTGTGGGGGCTGTCGTGGTCGCCGTGGCTGGAGCCATCTCTAGCTTCATTGCTTACCAGAAAAAGAAGCTATGCTTCAAAGAAAATGCAGAACAAGGGGAGGTGGACATGGAGAGCCACCGGAATGCCAACGCAGAGCCAGCTGTTCAGCGTACTCTTTTAGAGAAATAG |
| ORF Protein Sequence | MARGAALALLLFGLLGVLVAAPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADAPGVIPGIVGAVVVAVAGAISSFIAYQKKKLCFKENAEQGEVDMESHRNANAEPAVQRTLLEK |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-IO103-Ab | Anti-CD99/ MIC2/ HBA71 monoclonal antibody |
| Target Antigen | GM-Tg-g-IO103-Ag | MIC2/CD99 VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004612 | Human CD99 Lentivirus plasmid |
| ORF Viral Vector | pGMPC000443 | Human CD99 Mammalian (Non-Viral Vector) plasmid |
| ORF Viral Vector | vGMLP004612 | Human CD99 Lentivirus particle |
Target information
| Target ID | GM-IO103 |
| Target Name | MIC2 |
| Gene ID | 4267, 720563, 102902569, 609832, 509230, 100064394 |
| Gene Symbol and Synonyms | CD99,HBA71,MIC2,MIC2X,MIC2Y,MSK5X |
| Uniprot Accession | P14209 |
| Uniprot Entry Name | CD99_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | Cancer |
| Gene Ensembl | ENSG00000002586 |
| Target Classification | Checkpoint-Immuno Oncology, Tumor-associated antigen (TAA) |
The protein encoded by this gene is a cell surface glycoprotein involved in leukocyte migration, T-cell adhesion, ganglioside GM1 and transmembrane protein transport, and T-cell death by a caspase-independent pathway. In addition, the encoded protein may have the ability to rearrange the actin cytoskeleton and may also act as an oncosuppressor in osteosarcoma. This gene is found in the pseudoautosomal region of chromosomes X and Y and escapes X-chromosome inactivation. There is a related pseudogene located immediately adjacent to this locus. [provided by RefSeq, Mar 2016]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


