Human EEF1E1/AIMP3/P18 ORF/cDNA clone-Lentivirus particle (NM_004280)

Cat. No.: vGMLP004631

Pre-made Human EEF1E1/AIMP3/P18 Lentiviral expression plasmid for EEF1E1 lentivirus packaging, EEF1E1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to EEF1E1/AIMP3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004631 Human EEF1E1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004631
Gene Name EEF1E1
Accession Number NM_004280
Gene ID 9521
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 525 bp
Gene Alias AIMP3,P18
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGCGGCCGCAGAGTTGTCGCTACTGGAGAAGTCCCTGGGACTGAGTAAGGGGAATAAATACAGTGCTCAGGGCGAGCGACAGATTCCAGTTCTTCAGACAAACAATGGTCCAAGTCTAACAGGATTGACTACTATAGCAGCTCATCTAGTCAAGCAAGCCAACAAAGAATATTTGCTGGGGAGTACTGCAGAAGAAAAAGCAATCGTTCAGCAGTGGTTAGAATACAGGGTCACTCAAGTAGATGGGCACTCCAGTAAAAATGACATCCACACACTGTTGAAGGATCTTAATTCATATCTTGAAGATAAAGTCTACCTTACAGGGTATAACTTTACATTAGCAGATATACTATTGTACTATGGACTTCATCGCTTTATAGTTGACCTGACAGTTCAAGAAAAGGAGAAATATCTTAATGTGTCTCGCTGGTTTTGTCACATTCAGCATTATCCAGGCATCAGGCAACATCTGTCTAGTGTTGTCTTCATCAAGAACAGACTATATACTAATTCCCACTAG
ORF Protein Sequence MAAAAELSLLEKSLGLSKGNKYSAQGERQIPVLQTNNGPSLTGLTTIAAHLVKQANKEYLLGSTAEEKAIVQQWLEYRVTQVDGHSSKNDIHTLLKDLNSYLEDKVYLTGYNFTLADILLYYGLHRFIVDLTVQEKEKYLNVSRWFCHIQHYPGIRQHLSSVVFIKNRLYTNSH

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0740-Ab Anti-EEF1E1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0740-Ag EEF1E1 protein
    ORF Viral Vector pGMLP004631 Human EEF1E1 Lentivirus plasmid
    ORF Viral Vector vGMLP004631 Human EEF1E1 Lentivirus particle


    Target information

    Target ID GM-IP0740
    Target Name EEF1E1
    Gene ID 9521, 66143, 695426, 291057, 101097893, 478717, 617105, 100062116
    Gene Symbol and Synonyms 1110003A02Rik,AIMP3,EEF1E1,P18
    Uniprot Accession O43324
    Uniprot Entry Name MCA3_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000124802
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a multifunctional protein that localizes to both the cytoplasm and nucleus. In the cytoplasm, the encoded protein is an auxiliary component of the macromolecular aminoacyl-tRNA synthase complex. However, its mouse homolog has been shown to translocate to the nucleus in response to DNA damage, and it plays a positive role in ATM/ATR-mediated p53 activation. Alternative splicing results in multiple transcript variants. Read-through transcription also exists between this gene and the neighboring downstream MUTED (muted homolog) gene. An EEF1E1-related pseudogene has been identified on chromosome 2. [provided by RefSeq, Dec 2010]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.