Human PDPN/AGGRUS/GP36 ORF/cDNA clone-Lentivirus particle (NM_006474)
Cat. No.: vGMLP004978
Pre-made Human PDPN/AGGRUS/GP36 Lentiviral expression plasmid for PDPN lentivirus packaging, PDPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PDPN/AGGRUS products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP004978 | Human PDPN Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP004978 |
| Gene Name | PDPN |
| Accession Number | NM_006474 |
| Gene ID | 10630 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 717 bp |
| Gene Alias | AGGRUS,GP36,Gp38,GP40,HT1A-1,OTS8,PA2.26,T1A,T1A-2,T1A2,TI1A |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGGAAGGTGTCAGCTCTGCTCTTCGTTTTGGGAAGCGCGTCGCTCTGGGTCCTGGCAGAAGGAGCCAGCACAGGCCAGCCAGAAGATGACACTGAGACTACAGGTTTGGAAGGCGGCGTTGCCATGCCAGGTGCCGAAGATGATGTGGTGACTCCAGGAACCAGCGAAGACCGCTATAAGTCTGGCTTGACAACTCTGGTGGCAACAAGTGTCAACAGTGTAACAGGCATTCGCATCGAGGATCTGCCAACTTCAGAAAGCACAGTCCACGCGCAAGAACAAAGTCCAAGCGCCACAGCCTCAAACGTGGCCACCAGTCACTCCACGGAGAAAGTGGATGGAGACACACAGACAACAGTTGAGAAAGATGGTTTGTCAACAGTGACCCTGGTTGGAATCATAGTTGGGGTCTTACTAGCCATCGGCTTCATTGGTGCAATCATCGTTGTGGTTATGCGAAAAATGTCGGGAAGGTACTCGCCCTAA |
| ORF Protein Sequence | MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP1359-Ab | Anti-PDPN/ AGGRUS/ GP36 monoclonal antibody |
| Target Antigen | GM-Tg-g-MP1359-Ag | PDPN VLP (virus-like particle) |
| ORF Viral Vector | pGMLP004978 | Human PDPN Lentivirus plasmid |
| ORF Viral Vector | vGMLP004978 | Human PDPN Lentivirus particle |
Target information
| Target ID | GM-MP1359 |
| Target Name | PDPN |
| Gene ID | 10630, 14726, 716250, 54320, 101081910, 403886, 509732, 102148273 |
| Gene Symbol and Synonyms | AGGRUS,D2-40,E11,GP36,Gp38,GP40,HT1A-1,OTS-8,OTS8,PA2.26,PDPN,RANDAM-2,RTI40,T1-alpha,T1A,T1A-2,T1A2,T1alpha,TI1A |
| Uniprot Accession | Q86YL7 |
| Uniprot Entry Name | PDPN_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Cancer |
| Gene Ensembl | ENSG00000162493 |
| Target Classification | Tumor-associated antigen (TAA) |
This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


