Human PDPN/AGGRUS/GP36 ORF/cDNA clone-Lentivirus particle (NM_006474)

Cat. No.: vGMLP004978

Pre-made Human PDPN/AGGRUS/GP36 Lentiviral expression plasmid for PDPN lentivirus packaging, PDPN lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PDPN/AGGRUS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP004978 Human PDPN Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP004978
Gene Name PDPN
Accession Number NM_006474
Gene ID 10630
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 717 bp
Gene Alias AGGRUS,GP36,Gp38,GP40,HT1A-1,OTS8,PA2.26,T1A,T1A-2,T1A2,TI1A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTGGAAGGTGTCAGCTCTGCTCTTCGTTTTGGGAAGCGCGTCGCTCTGGGTCCTGGCAGAAGGAGCCAGCACAGGCCAGCCAGAAGATGACACTGAGACTACAGGTTTGGAAGGCGGCGTTGCCATGCCAGGTGCCGAAGATGATGTGGTGACTCCAGGAACCAGCGAAGACCGCTATAAGTCTGGCTTGACAACTCTGGTGGCAACAAGTGTCAACAGTGTAACAGGCATTCGCATCGAGGATCTGCCAACTTCAGAAAGCACAGTCCACGCGCAAGAACAAAGTCCAAGCGCCACAGCCTCAAACGTGGCCACCAGTCACTCCACGGAGAAAGTGGATGGAGACACACAGACAACAGTTGAGAAAGATGGTTTGTCAACAGTGACCCTGGTTGGAATCATAGTTGGGGTCTTACTAGCCATCGGCTTCATTGGTGCAATCATCGTTGTGGTTATGCGAAAAATGTCGGGAAGGTACTCGCCCTAA
ORF Protein Sequence MWKVSALLFVLGSASLWVLAEGASTGQPEDDTETTGLEGGVAMPGAEDDVVTPGTSEDRYKSGLTTLVATSVNSVTGIRIEDLPTSESTVHAQEQSPSATASNVATSHSTEKVDGDTQTTVEKDGLSTVTLVGIIVGVLLAIGFIGAIIVVVMRKMSGRYSP

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1359-Ab Anti-PDPN/ AGGRUS/ GP36 monoclonal antibody
    Target Antigen GM-Tg-g-MP1359-Ag PDPN VLP (virus-like particle)
    ORF Viral Vector pGMLP004978 Human PDPN Lentivirus plasmid
    ORF Viral Vector vGMLP004978 Human PDPN Lentivirus particle


    Target information

    Target ID GM-MP1359
    Target Name PDPN
    Gene ID 10630, 14726, 716250, 54320, 101081910, 403886, 509732, 102148273
    Gene Symbol and Synonyms AGGRUS,D2-40,E11,GP36,Gp38,GP40,HT1A-1,OTS-8,OTS8,PA2.26,PDPN,RANDAM-2,RTI40,T1-alpha,T1A,T1A-2,T1A2,T1alpha,TI1A
    Uniprot Accession Q86YL7
    Uniprot Entry Name PDPN_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Cancer
    Gene Ensembl ENSG00000162493
    Target Classification Tumor-associated antigen (TAA)

    This gene encodes a type-I integral membrane glycoprotein with diverse distribution in human tissues. The physiological function of this protein may be related to its mucin-type character. The homologous protein in other species has been described as a differentiation antigen and influenza-virus receptor. The specific function of this protein has not been determined but it has been proposed as a marker of lung injury. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.