Human Nkx2.8/Nkx2-9/NKX2.8 ORF/cDNA clone-Lentivirus particle (NM_014360)
Cat. No.: vGMLP005135
Pre-made Human Nkx2.8/Nkx2-9/NKX2.8 Lentiviral expression plasmid for Nkx2.8 lentivirus packaging, Nkx2.8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
NKX2-8/Nkx2.8/Nkx2-9 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP005135 | Human Nkx2.8 Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP005135 |
Gene Name | Nkx2.8 |
Accession Number | NM_014360 |
Gene ID | 26257 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 720 bp |
Gene Alias | Nkx2-9,NKX2.8,NKX2H |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCCACCTCTGGACGCCTGAGCTTCACCGTGCGCAGCCTTCTAGATTTACCCGAGCAGGACGCGCAACACCTGCCGAGGCGGGAGCCAGAACCACGCGCCCCCCAGCCCGACCCCTGCGCCGCCTGGCTGGATTCGGAGCGCGGCCACTACCCTTCCTCGGACGAGAGCAGCCTGGAGACCAGCCCGCCAGACTCGTCGCAGCGGCCGTCCGCTAGGCCCGCGTCTCCGGGCTCGGACGCCGAGAAAAGGAAGAAGCGGCGGGTGCTATTCTCCAAGGCGCAGACGCTGGAGTTGGAGCGGCGCTTCCGGCAGCAGCGGTACCTGTCTGCGCCCGAGCGCGAGCAGCTGGCGAGCCTGCTTCGCCTCACGCCCACGCAGGTCAAGATCTGGTTCCAGAATCATCGCTACAAGCTGAAGCGCGCTCGCGCTCCAGGGGCGGCGGAGTCGCCTGACCTGGCAGCATCCGCCGAGCTGCACGCCGCGCCCGGCCTGCTGCGTCGCGTGGTGGTGCCGGTGCTTGTTCGCGACGGGCAGCCGTGCGGCGGCGGCGGCGGTGGCGAGGTGGGAACCGCCGCGGCCCAGGAGAAGTGCGGCGCCCCTCCAGCCGCCGCCTGCCCTCTGCCGGGCTACCCTGCCTTCGGTCCCGGCTCGGCGCTTGGCCTCTTCCCCGCCTACCAGCACTTAGCATCCCCCGCCCTGGTCTCCTGGAACTGGTGA |
ORF Protein Sequence | MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP2628-Ab | Anti-NKX2-8 monoclonal antibody |
Target Antigen | GM-Tg-g-IP2628-Ag | NKX2-8 protein |
ORF Viral Vector | pGMLP005135 | Human Nkx2.8 Lentivirus plasmid |
ORF Viral Vector | vGMLP005135 | Human Nkx2.8 Lentivirus particle |
Target information
Target ID | GM-IP2628 |
Target Name | NKX2-8 |
Gene ID | 26257, 18094, 696564, 299061, 101085383, 609776, 539075, 106782219 |
Gene Symbol and Synonyms | Nkx-2.9,NKX2-8,Nkx2-9,NKX2.8,Nkx2.9,NKX2H,tinman |
Uniprot Accession | O15522 |
Uniprot Entry Name | NKX28_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000136327 |
Target Classification | Not Available |
The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in some lung cancers and is linked to poor patient survival, possibly due to its resistance to cisplatin. This gene is aberrantly methylated in pancreatic cancer, deleted in squamous cell lung carcinomas, and acts as a tumor suppressor in esophageal cancer. Mutations in this gene may also be a cause of neural tube defects. [provided by RefSeq, Dec 2015]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.