Human Nkx2.8/Nkx2-9/NKX2.8 ORF/cDNA clone-Lentivirus particle (NM_014360)

Cat. No.: vGMLP005135

Pre-made Human Nkx2.8/Nkx2-9/NKX2.8 Lentiviral expression plasmid for Nkx2.8 lentivirus packaging, Nkx2.8 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to NKX2-8/Nkx2.8/Nkx2-9 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005135 Human Nkx2.8 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005135
Gene Name Nkx2.8
Accession Number NM_014360
Gene ID 26257
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 720 bp
Gene Alias Nkx2-9,NKX2.8,NKX2H
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCCACCTCTGGACGCCTGAGCTTCACCGTGCGCAGCCTTCTAGATTTACCCGAGCAGGACGCGCAACACCTGCCGAGGCGGGAGCCAGAACCACGCGCCCCCCAGCCCGACCCCTGCGCCGCCTGGCTGGATTCGGAGCGCGGCCACTACCCTTCCTCGGACGAGAGCAGCCTGGAGACCAGCCCGCCAGACTCGTCGCAGCGGCCGTCCGCTAGGCCCGCGTCTCCGGGCTCGGACGCCGAGAAAAGGAAGAAGCGGCGGGTGCTATTCTCCAAGGCGCAGACGCTGGAGTTGGAGCGGCGCTTCCGGCAGCAGCGGTACCTGTCTGCGCCCGAGCGCGAGCAGCTGGCGAGCCTGCTTCGCCTCACGCCCACGCAGGTCAAGATCTGGTTCCAGAATCATCGCTACAAGCTGAAGCGCGCTCGCGCTCCAGGGGCGGCGGAGTCGCCTGACCTGGCAGCATCCGCCGAGCTGCACGCCGCGCCCGGCCTGCTGCGTCGCGTGGTGGTGCCGGTGCTTGTTCGCGACGGGCAGCCGTGCGGCGGCGGCGGCGGTGGCGAGGTGGGAACCGCCGCGGCCCAGGAGAAGTGCGGCGCCCCTCCAGCCGCCGCCTGCCCTCTGCCGGGCTACCCTGCCTTCGGTCCCGGCTCGGCGCTTGGCCTCTTCCCCGCCTACCAGCACTTAGCATCCCCCGCCCTGGTCTCCTGGAACTGGTGA
ORF Protein Sequence MATSGRLSFTVRSLLDLPEQDAQHLPRREPEPRAPQPDPCAAWLDSERGHYPSSDESSLETSPPDSSQRPSARPASPGSDAEKRKKRRVLFSKAQTLELERRFRQQRYLSAPEREQLASLLRLTPTQVKIWFQNHRYKLKRARAPGAAESPDLAASAELHAAPGLLRRVVVPVLVRDGQPCGGGGGGEVGTAAAQEKCGAPPAAACPLPGYPAFGPGSALGLFPAYQHLASPALVSWNW

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP2628-Ab Anti-NKX2-8 monoclonal antibody
    Target Antigen GM-Tg-g-IP2628-Ag NKX2-8 protein
    ORF Viral Vector pGMLP005135 Human Nkx2.8 Lentivirus plasmid
    ORF Viral Vector vGMLP005135 Human Nkx2.8 Lentivirus particle


    Target information

    Target ID GM-IP2628
    Target Name NKX2-8
    Gene ID 26257, 18094, 696564, 299061, 101085383, 609776, 539075, 106782219
    Gene Symbol and Synonyms Nkx-2.9,NKX2-8,Nkx2-9,NKX2.8,Nkx2.9,NKX2H,tinman
    Uniprot Accession O15522
    Uniprot Entry Name NKX28_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000136327
    Target Classification Not Available

    The protein encoded by this gene is a homeobox-containing developmental regulator associated with liver development. The encoded protein binds to the alpha-fetoprotein (AFP) gene promoter and increases the expression of AFP. This gene is overexpressed in some lung cancers and is linked to poor patient survival, possibly due to its resistance to cisplatin. This gene is aberrantly methylated in pancreatic cancer, deleted in squamous cell lung carcinomas, and acts as a tumor suppressor in esophageal cancer. Mutations in this gene may also be a cause of neural tube defects. [provided by RefSeq, Dec 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.