Human HRAS/C-BAS/HAS/C-H-RAS ORF/cDNA clone-Lentivirus particle (NM_005343.3)

Cat. No.: vGMLP005795

Pre-made Human HRAS/C-BAS/HAS/C-H-RAS Lentiviral expression plasmid for HRAS lentivirus packaging, HRAS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to HRAS/C-BAS/HAS products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP005795 Human HRAS Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP005795
Gene Name HRAS
Accession Number NM_005343.3
Gene ID 3265
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 570 bp
Gene Alias C-BAS/HAS,C-H-RAS,C-HA-RAS1,c-K-ras,c-Ki-ras,CTLO,H-RASIDX,HAMSV,HRAS1,Ki-Ras,KRAS,KRAS2,p21ras,RASH1,RASK2
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACGGAATATAAGCTGGTGGTGGTGGGCGCCGGCGGTGTGGGCAAGAGTGCGCTGACCATCCAGCTGATCCAGAACCATTTTGTGGACGAATACGACCCCACTATAGAGGATTCCTACCGGAAGCAGGTGGTCATTGATGGGGAGACGTGCCTGTTGGACATCCTGGATACCGCCGGCCAGGAGGAGTACAGCGCCATGCGGGACCAGTACATGCGCACCGGGGAGGGCTTCCTGTGTGTGTTTGCCATCAACAACACCAAGTCTTTTGAGGACATCCACCAGTACAGGGAGCAGATCAAACGGGTGAAGGACTCGGATGACGTGCCCATGGTGCTGGTGGGGAACAAGTGTGACCTGGCTGCACGCACTGTGGAATCTCGGCAGGCTCAGGACCTCGCCCGAAGCTACGGCATCCCCTACATCGAGACCTCGGCCAAGACCCGGCAGGGAGTGGAGGATGCCTTCTACACGTTGGTGCGTGAGATCCGGCAGCACAAGCTGCGGAAGCTGAACCCTCCTGATGAGAGTGGCCCCGGCTGCATGAGCTGCAAGTGTGTGCTCTCCTGA
ORF Protein Sequence MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T71081-Ab Anti-HRAS monoclonal antibody
    Target Antigen GM-Tg-g-T71081-Ag HRAS protein
    ORF Viral Vector pGMLP000856 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005584 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005791 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005792 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005793 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005794 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005795 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005796 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005797 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005798 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005799 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP005808 Human HRAS Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-052 Human HRas Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-192 Human HRas Adenovirus plasmid
    ORF Viral Vector vGMLP000856 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005584 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005791 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005792 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005793 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005794 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005795 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005796 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005797 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005798 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005799 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP005808 Human HRAS Lentivirus particle
    ORF Viral Vector vGMLP-SPh-052 Human HRas Lentivirus particle
    ORF Viral Vector vGMAP-SPh-192 Human HRas Adenovirus particle


    Target information

    Target ID GM-T71081
    Target Name HRAS
    Gene ID 3265, 15461, 698830, 293621, 751103, 403735, 100298939, 100055481
    Gene Symbol and Synonyms C-BAS/HAS,C-H-RAS,c-Ha-ras,C-HA-RAS1,c-rasHa,CTLO,H-ras,H-RASIDX,Ha-ras,HAMSV,Harvey-ras,HRAS,Hras-1,HRAS1,Kras2,p21ras,ras,RASH1
    Uniprot Accession P01112
    Uniprot Entry Name RASH_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Non-Small Cell Lung Cancer
    Gene Ensembl ENSG00000174775
    Target Classification Not Available

    This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.