Human HRAS/C-BAS/HAS/C-H-RAS ORF/cDNA clone-Lentivirus particle (NM_005343.3)
Cat. No.: vGMLP005796
Pre-made Human HRAS/C-BAS/HAS/C-H-RAS Lentiviral expression plasmid for HRAS lentivirus packaging, HRAS lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
HRAS/C-BAS/HAS products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
---|---|---|---|
vGMLP005796 | Human HRAS Lentivirus particle | Pilot Grade | 1.0E+8TU |
5.0E+8TU | |||
1.0E+9TU | |||
Research Grade | 1.0E+8TU | ||
5.0E+8TU | |||
1.0E+9TU | |||
GMP-like Grade | inquiry | ||
GMP Grade | inquiry |
Product Description
Catalog ID | vGMLP005796 |
Gene Name | HRAS |
Accession Number | NM_005343.3 |
Gene ID | 3265 |
Species | Human |
Product Type | Lentivirus particle (overexpression) |
Insert Length | 570 bp |
Gene Alias | C-BAS/HAS,C-H-RAS,C-HA-RAS1,c-K-ras,c-Ki-ras,CTLO,H-RASIDX,HAMSV,HRAS1,Ki-Ras,KRAS,KRAS2,p21ras,RASH1,RASK2 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGACGGAATATAAGCTGGTGGTGGTGGGCGCCGGCGGTGTGGGCAAGAGTGCGCTGACCATCCAGCTGATCCAGAACCATTTTGTGGACGAATACGACCCCACTATAGAGGATTCCTACCGGAAGCAGGTGGTCATTGATGGGGAGACGTGCCTGTTGGACATCCTGGATACCGCCGGCCAGGAGGAGTACAGCGCCATGCGGGACCAGTACATGCGCACCGGGGAGGGCTTCCTGTGTGTGTTTGCCATCAACAACACCAAGTCTTTTGAGGACATCCACCAGTACAGGGAGCAGATCAAACGGGTGAAGGACTCGGATGACGTGCCCATGGTGCTGGTGGGGAACAAGTGTGACCTGGCTGCACGCACTGTGGAATCTCGGCAGGCTCAGGACCTCGCCCGAAGCTACGGCATCCCCTACATCGAGACCTCGGCCAAGACCCGGCAGGGAGTGGAGGATGCCTTCTACACGTTGGTGCGTGAGATCCGGCAGCACAAGCTGCGGAAGCTGAACCCTCCTGATGAGAGTGGCCCCGGCTGCATGAGCTGCAAGTGTGTGCTCTCCTGA |
ORF Protein Sequence | MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPGCMSCKCVLS |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-T71081-Ab | Anti-HRAS monoclonal antibody |
Target Antigen | GM-Tg-g-T71081-Ag | HRAS protein |
ORF Viral Vector | pGMLP000856 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005584 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005791 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005792 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005793 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005794 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005795 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005796 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005797 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005798 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005799 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP005808 | Human HRAS Lentivirus plasmid |
ORF Viral Vector | pGMLP-SPh-052 | Human HRas Lentivirus plasmid |
ORF Viral Vector | pGMAP-SPh-192 | Human HRas Adenovirus plasmid |
ORF Viral Vector | vGMLP000856 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005584 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005791 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005792 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005793 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005794 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005795 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005796 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005797 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005798 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005799 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP005808 | Human HRAS Lentivirus particle |
ORF Viral Vector | vGMLP-SPh-052 | Human HRas Lentivirus particle |
ORF Viral Vector | vGMAP-SPh-192 | Human HRas Adenovirus particle |
Target information
Target ID | GM-T71081 |
Target Name | HRAS |
Gene ID | 3265, 15461, 698830, 293621, 751103, 403735, 100298939, 100055481 |
Gene Symbol and Synonyms | C-BAS/HAS,C-H-RAS,c-Ha-ras,C-HA-RAS1,c-rasHa,CTLO,H-ras,H-RASIDX,Ha-ras,HAMSV,Harvey-ras,HRAS,Hras-1,HRAS1,Kras2,p21ras,ras,RASH1 |
Uniprot Accession | P01112 |
Uniprot Entry Name | RASH_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Non-Small Cell Lung Cancer |
Gene Ensembl | ENSG00000174775 |
Target Classification | Not Available |
This gene belongs to the Ras oncogene family, whose members are related to the transforming genes of mammalian sarcoma retroviruses. The products encoded by these genes function in signal transduction pathways. These proteins can bind GTP and GDP, and they have intrinsic GTPase activity. This protein undergoes a continuous cycle of de- and re-palmitoylation, which regulates its rapid exchange between the plasma membrane and the Golgi apparatus. Mutations in this gene cause Costello syndrome, a disease characterized by increased growth at the prenatal stage, growth deficiency at the postnatal stage, predisposition to tumor formation, cognitive disability, skin and musculoskeletal abnormalities, distinctive facial appearance and cardiovascular abnormalities. Defects in this gene are implicated in a variety of cancers, including bladder cancer, follicular thyroid cancer, and oral squamous cell carcinoma. Multiple transcript variants, which encode different isoforms, have been identified for this gene. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.