Mouse Ucn3/ucn III ORF/cDNA clone-Lentivirus particle (NM_031250)

Cat. No.: vGMLPm000234

Pre-made Mouse Ucn3/ucn III Lentiviral expression plasmid for Ucn3 lentivirus packaging, Ucn3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLPm000234 Mouse Ucn3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLPm000234
Gene Name Ucn3
Accession Number NM_031250
Gene ID 83428
Species Mouse
Product Type Lentivirus particle (overexpression)
Insert Length 495 bp
Gene Alias ucn III
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGCTGATGCCCACCTACTTCCTGCTGCCACTTCTGCTGCTCCTAGGAGGTCCAAGGACAAGCCTCTCCCACAAGTTCTACAACACTGGACCAGTCTTCAGCTGCCTCAACACAGCCCTATCTGAGGTCAAGAAGAACAAGCTGGAAGATGTGCCCTTGCTGAGCAAGAAGAGCTTTGGCCACCTGCCCACACAAGACCCCTCAGGGGAAGAAGATGACAACCAAACGCACCTCCAGATCAAAAGAACTTTCTCAGGTGCCGCGGGTGGGAATGGAGCTGGGAGCACCCGGTACAGATACCAATCCCAGGCACAGCACAAGGGGAAGCTGTACCCAGACAAGCCCAAAAGCGACCGGGGCACCAAGTTCACCCTTTCCCTTGATGTTCCCACTAACATCATGAACATCCTCTTCAACATCGACAAGGCCAAGAATTTGCGAGCCAAGGCAGCTGCCAATGCTCAGCTCATGGCACAGATTGGGAAGAAGAAGTAA
ORF Protein Sequence MLMPTYFLLPLLLLLGGPRTSLSHKFYNTGPVFSCLNTALSEVKKNKLEDVPLLSKKSFGHLPTQDPSGEEDDNQTHLQIKRTFSGAAGGNGAGSTRYRYQSQAQHKGKLYPDKPKSDRGTKFTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQIGKKK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    ORF Viral Vector pGMLPm000234 Mouse Ucn3 Lentivirus plasmid




    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.