Human ERP29/C12orf8/ERp28 ORF/cDNA clone-Lentivirus particle (NM_006817.3)

Cat. No.: vGMLV000183

Pre-made Human ERP29/C12orf8/ERp28 Lentiviral expression plasmid for ERP29 lentivirus packaging, ERP29 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to ERP29/C12orf8 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV000183 Human ERP29 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV000183
Gene Name ERP29
Accession Number NM_006817.3
Gene ID 10961
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 786 bp
Gene Alias C12orf8,ERp28,ERp31,HEL-S-107,PDI-DB,PDIA9
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCTGCCGCTGTGCCCCGCGCCGCATTTCTCTCCCCGCTGCTTCCCCTTCTCCTGGGCTTCCTGCTCCTCTCCGCTCCGCATGGCGGCAGCGGCCTGCACACCAAGGGCGCCCTTCCCCTGGATACGGTCACTTTCTACAAGGTCATTCCCAAAAGCAAGTTCGTCTTGGTGAAGTTCGACACCCAGTACCCCTACGGTGAGAAGCAGGATGAGTTCAAGCGTCTTGCTGAAAACTCGGCTTCCAGCGATGATCTCTTGGTGGCAGAGGTGGGGATCTCAGATTATGGTGACAAGCTGAACATGGAGCTGAGTGAGAAATACAAGCTGGACAAAGAGAGCTACCCAGTCTTCTACCTCTTCCGGGATGGGGACTTTGAGAACCCAGTCCCATACACTGGGGCAGTTAAGGTTGGAGCCATCCAGCGCTGGCTGAAGGGGCAAGGGGTCTACCTAGGTATGCCTGGTTGCCTGCCTGTATACGACGCCCTGGCCGGGGAGTTCATCAGGGCCTCTGGTGTGGAGGCCCGCCAGGCCCTCTTGAAGCAGGGGCAAGATAACCTCTCAAGTGTGAAGGAGACTCAGAAGAAGTGGGCCGAGCAATACCTGAAGATCATGGGGAAGATCTTAGACCAAGGGGAGGACTTCCCAGCATCAGAGATGACACGGATCGCCAGGCTGATTGAGAAGAACAAGATGAGTGACGGGAAGAAGGAGGAGCTCCAGAAGAGCTTAAACATCCTGACTGCCTTCCAGAAGAAGGGGGCCGAGAAAGAGGAGCTGTAA
ORF Protein Sequence MAAAVPRAAFLSPLLPLLLGFLLLSAPHGGSGLHTKGALPLDTVTFYKVIPKSKFVLVKFDTQYPYGEKQDEFKRLAENSASSDDLLVAEVGISDYGDKLNMELSEKYKLDKESYPVFYLFRDGDFENPVPYTGAVKVGAIQRWLKGQGVYLGMPGCLPVYDALAGEFIRASGVEARQALLKQGQDNLSSVKETQKKWAEQYLKIMGKILDQGEDFPASEMTRIARLIEKNKMSDGKKEELQKSLNILTAFQKKGAEKEEL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-SE0187-Ab Anti-ERP29/ C12orf8/ ERp28 functional antibody
    Target Antigen GM-Tg-g-SE0187-Ag ERP29 protein
    ORF Viral Vector pGMLV000183 Human ERP29 Lentivirus plasmid
    ORF Viral Vector vGMLV000183 Human ERP29 Lentivirus particle


    Target information

    Target ID GM-SE0187
    Target Name ERP29
    Gene ID 10961, 67397, 711484, 117030, 101083974, 477482, 613357, 100057258
    Gene Symbol and Synonyms 1200015M03Rik,2810446M09Rik,C12orf8,ERp28,ERP29,ERp31,HEL-S-107,PDI-DB,PDIA9
    Uniprot Accession P30040
    Uniprot Entry Name ERP29_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000089248
    Target Classification Not Available

    This gene encodes a protein which localizes to the lumen of the endoplasmic reticulum (ER). It is a member of the protein disulfide isomerase (PDI) protein family but lacks an active thioredoxin motif, suggesting that this protein does not function as a disulfide isomerase. The canonical protein dimerizes and is thought to play a role in the processing of secretory proteins within the ER. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Dec 2016]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.