Human CCL20/CKb4/Exodus ORF/cDNA clone-Lentivirus particle (NM_004591.2)
Cat. No.: vGMLV000235
Pre-made Human CCL20/CKb4/Exodus Lentiviral expression plasmid for CCL20 lentivirus packaging, CCL20 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
CCL20/CKb4 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV000235 | Human CCL20 Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV000235 |
| Gene Name | CCL20 |
| Accession Number | NM_004591.2 |
| Gene ID | 6364 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 291 bp |
| Gene Alias | CKb4,Exodus,LARC,MIP-3-alpha,MIP-3a,MIP3A,SCYA20,ST38 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGTGCTGTACCAAGAGTTTGCTCCTGGCTGCTTTGATGTCAGTGCTGCTACTCCACCTCTGCGGCGAATCAGAAGCAGCAAGCAACTTTGACTGCTGTCTTGGATACACAGACCGTATTCTTCATCCTAAATTTATTGTGGGCTTCACACGGCAGCTGGCCAATGAAGGCTGTGACATCAATGCTATCATCTTTCACACAAAGAAAAAGTTGTCTGTGTGCGCAAATCCAAAACAGACTTGGGTGAAATATATTGTGCGTCTCCTCAGTAAAAAAGTCAAGAACATGTAA |
| ORF Protein Sequence | MCCTKSLLLAALMSVLLLHLCGESEAASNFDCCLGYTDRILHPKFIVGFTRQLANEGCDINAIIFHTKKKLSVCANPKQTWVKYIVRLLSKKVKNM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T04894-Ab | Anti-CCL20/ CKb4/ Exodus functional antibody |
| Target Antigen | GM-Tg-g-T04894-Ag | CCL20 protein |
| Cytokine | cks-Tg-g-GM-T04894 | chemokine (C-C motif) ligand 20 (CCL20) protein & antibody |
| ORF Viral Vector | pGMLV000235 | Human CCL20 Lentivirus plasmid |
| ORF Viral Vector | pGMAAV000788 | Human CCL20 Adeno-associate virus(AAV) plasmid |
| ORF Viral Vector | vGMLV000235 | Human CCL20 Lentivirus particle |
| ORF Viral Vector | vGMAAV000788 | Human CCL20 Adeno-associate virus(AAV) particle |
Target information
| Target ID | GM-T04894 |
| Target Name | CCL20 |
| Gene ID | 6364, 20297, 574182, 29538, 101089032, 448790, 281666, 100629808 |
| Gene Symbol and Synonyms | CCL20,CKb4,Exodus,exodus-1,LARC,MIP-3-alpha,MIP-3a,MIP-3[a],MIP3A,SCYA20,ST38 |
| Uniprot Accession | P78556 |
| Uniprot Entry Name | CCL20_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, Immuno-oncology Target, Cytokine Target |
| Disease | Prostate Cancer |
| Gene Ensembl | ENSG00000115009 |
| Target Classification | Checkpoint-Immuno Oncology |
This antimicrobial gene belongs to the subfamily of small cytokine CC genes. Cytokines are a family of secreted proteins involved in immunoregulatory and inflammatory processes. The CC cytokines are proteins characterized by two adjacent cysteines. The protein encoded by this gene displays chemotactic activity for lymphocytes and can repress proliferation of myeloid progenitors. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2014]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


