Human THY1/CD90/CDw90 ORF/cDNA clone-Lentivirus particle (NM_001311160.2)

Cat. No.: vGMLV001723

Pre-made Human THY1/CD90/CDw90 Lentiviral expression plasmid for THY1 lentivirus packaging, THY1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to THY1/CD90 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001723 Human THY1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001723
Gene Name THY1
Accession Number NM_001311160.2
Gene ID 7070
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 486 bp
Gene Alias CD90,CDw90
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAACCTGGCCATCAGCATCGCTCTCCTGCTAACAGTCTTGCAGGTCTCCCGAGGGCAGAAGGTGACCAGCCTAACGGCCTGCCTAGTGGACCAGAGCCTTCGTCTGGACTGCCGCCATGAGAATACCAGCAGTTCACCCATCCAGTACGAGTTCAGCCTGACCCGTGAGACAAAGAAGCACGTGCTCTTTGGCACTGTGGGGGTGCCTGAGCACACATACCGCTCCCGAACCAACTTCACCAGCAAATACAACATGAAGGTCCTCTACTTATCCGCCTTCACTAGCAAGGACGAGGGCACCTACACGTGTGCACTCCACCACTCTGGCCATTCCCCACCCATCTCCTCCCAGAACGTCACAGTGCTCAGAGACAAACTGGTCAAGTGTGAGGGCATCAGCCTGCTGGCTCAGAACACCTCGTGGCTGCTGCTGCTCCTGCTCTCCCTCTCCCTCCTCCAGGCCACGGATTTCATGTCCCTGTGA
ORF Protein Sequence MNLAISIALLLTVLQVSRGQKVTSLTACLVDQSLRLDCRHENTSSSPIQYEFSLTRETKKHVLFGTVGVPEHTYRSRTNFTSKYNMKVLYLSAFTSKDEGTYTCALHHSGHSPPISSQNVTVLRDKLVKCEGISLLAQNTSWLLLLLLSLSLLQATDFMSL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1797-Ab Anti-THY1/ CD90/ CDw90 monoclonal antibody
    Target Antigen GM-Tg-g-MP1797-Ag THY1 VLP (virus-like particle)
    ORF Viral Vector pGMLP002825 Human THY1 Lentivirus plasmid
    ORF Viral Vector pGMLV001723 Human THY1 Lentivirus plasmid
    ORF Viral Vector vGMLP002825 Human THY1 Lentivirus particle
    ORF Viral Vector vGMLV001723 Human THY1 Lentivirus particle


    Target information

    Target ID GM-MP1797
    Target Name THY1
    Gene ID 7070, 21838, 705321, 24832, 101098005, 489365, 614712, 100063377
    Gene Symbol and Synonyms CD7,CD90,CDw90,T25,Thy-1,Thy-1.2,THY1,Thy1.1,Thy1.2
    Uniprot Accession P04216
    Uniprot Entry Name THY1_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Prostate Cancer, Malignant neoplasm of prostate
    Gene Ensembl ENSG00000154096
    Target Classification Not Available

    This gene encodes a cell surface glycoprotein and member of the immunoglobulin superfamily of proteins. The encoded protein is involved in cell adhesion and cell communication in numerous cell types, but particularly in cells of the immune and nervous systems. The encoded protein is widely used as a marker for hematopoietic stem cells. This gene may function as a tumor suppressor in nasopharyngeal carcinoma. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.