Human NPPA/ANF/ANP ORF/cDNA clone-Lentivirus particle (NM_006172.4)
Cat. No.: vGMLV002264
Pre-made Human NPPA/ANF/ANP Lentiviral expression plasmid for NPPA lentivirus packaging, NPPA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
NPPA/ANF products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLV002264 | Human NPPA Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLV002264 |
| Gene Name | NPPA |
| Accession Number | NM_006172.4 |
| Gene ID | 4878 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 456 bp |
| Gene Alias | ANF,ANP,ATFB6,ATRST2,CDD,CDD-ANF,CDP,PND |
| Fluorescent Reporter | Null |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGAGCTCCTTCTCCACCACCACCGTGAGCTTCCTCCTTTTACTGGCATTCCAGCTCCTAGGTCAGACCAGAGCTAATCCCATGTACAATGCCGTGTCCAACGCAGACCTGATGGATTTCAAGAATTTGCTGGACCATTTGGAAGAAAAGATGCCTTTAGAAGATGAGGTCGTGCCCCCACAAGTGCTCAGTGAGCCGAATGAAGAAGCGGGGGCTGCTCTCAGCCCCCTCCCTGAGGTGCCTCCCTGGACCGGGGAAGTCAGCCCAGCCCAGAGAGATGGAGGTGCCCTCGGGCGGGGCCCCTGGGACTCCTCTGATCGATCTGCCCTCCTAAAAAGCAAGCTGAGGGCGCTGCTCACTGCCCCTCGGAGCCTGCGGAGATCCAGCTGCTTCGGGGGCAGGATGGACAGGATTGGAGCCCAGAGCGGACTGGGCTGTAACAGCTTCCGGTACTGA |
| ORF Protein Sequence | MSSFSTTTVSFLLLLAFQLLGQTRANPMYNAVSNADLMDFKNLLDHLEEKMPLEDEVVPPQVLSEPNEEAGAALSPLPEVPPWTGEVSPAQRDGGALGRGPWDSSDRSALLKSKLRALLTAPRSLRRSSCFGGRMDRIGAQSGLGCNSFRY |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-SE0373-Ab | Anti-ANF/ NPPA/ ANP functional antibody |
| Target Antigen | GM-Tg-g-SE0373-Ag | NPPA protein |
| ORF Viral Vector | pGMLP000970 | Human NPPA Lentivirus plasmid |
| ORF Viral Vector | pGMLV002264 | Human NPPA Lentivirus plasmid |
| ORF Viral Vector | vGMLP000970 | Human NPPA Lentivirus particle |
| ORF Viral Vector | vGMLV002264 | Human NPPA Lentivirus particle |
Target information
| Target ID | GM-SE0373 |
| Target Name | NPPA |
| Gene ID | 4878, 230899, 714994, 24602, 101100575, 608289, 281355, 100034201 |
| Gene Symbol and Synonyms | ANF,ANP,ATFB6,ATRST2,CDD,CDD-ANF,CDP,NPPA,PND,preproANF,preproANP,proANF,proANP,RATANF |
| Uniprot Accession | P01160 |
| Uniprot Entry Name | ANF_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Diagnostics Biomarker |
| Disease | Not Available |
| Gene Ensembl | ENSG00000175206 |
| Target Classification | Not Available |
The protein encoded by this gene belongs to the natriuretic peptide family. Natriuretic peptides are implicated in the control of extracellular fluid volume and electrolyte homeostasis. This protein is synthesized as a large precursor (containing a signal peptide), which is processed to release a peptide from the N-terminus with similarity to vasoactive peptide, cardiodilatin, and another peptide from the C-terminus with natriuretic-diuretic activity. Mutations in this gene have been associated with atrial fibrillation familial type 6. This gene is located adjacent to another member of the natriuretic family of peptides on chromosome 1. [provided by RefSeq, Oct 2015]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


