Human FIS1/CGI-135/TTC11 ORF/cDNA clone-Adenovirus plasmid (NM_016068)

Cat. No.: pGMAP-SPh-233
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human FIS1/CGI-135/TTC11 adenoviral expression plasmid for FIS1 adenovirus packaging, FIS1 adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to FIS1/CGI-135 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP-SPh-233
Gene Name FIS1
Accession Number NM_016068
Gene ID 51024
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 459 bp
Gene Alias CGI-135,TTC11
Fluorescent Reporter EGFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Amplicin
ORF Nucleotide Sequence ATGGAGGCCGTGCTGAACGAGCTGGTGTCTGTGGAGGACCTGCTGAAGTTTGAAAAGAAATTTCAGTCTGAGAAGGCAGCAGGCTCGGTGTCCAAGAGCACGCAGTTTGAGTACGCCTGGTGCCTGGTGCGGAGCAAGTACAATGATGACATCCGTAAAGGCATCGTGCTGCTCGAGGAGCTGCTGCCCAAAGGGAGCAAGGAGGAACAGCGGGATTACGTCTTCTACCTGGCCGTGGGGAACTACCGGCTCAAGGAATACGAGAAGGCCTTAAAGTACGTCCGCGGGTTGCTGCAGACAGAGCCCCAGAACAACCAGGCCAAGGAACTGGAGCGGCTCATTGACAAGGCCATGAAGAAAGATGGACTCGTGGGCATGGCCATCGTGGGAGGCATGGCCCTGGGTGTGGCGGGACTGGCCGGACTCATCGGACTTGCTGTGTCCAAGTCCAAATCCTGA
ORF Protein Sequence MEAVLNELVSVEDLLKFEKKFQSEKAAGSVSKSTQFEYAWCLVRSKYNDDIRKGIVLLEELLPKGSKEEQRDYVFYLAVGNYRLKEYEKALKYVRGLLQTEPQNNQAKELERLIDKAMKKDGLVGMAIVGGMALGVAGLAGLIGLAVSKSKS

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0847-Ab Anti-FIS1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0847-Ag FIS1 protein
    ORF Viral Vector pGMLP002675 Human FIS1 Lentivirus plasmid
    ORF Viral Vector pGMAD000275 Human FIS1 Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-093 Human FIS1 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-233 Human FIS1 Adenovirus plasmid
    ORF Viral Vector vGMLP002675 Human FIS1 Lentivirus particle
    ORF Viral Vector vGMAD000275 Human FIS1 Adenovirus particle
    ORF Viral Vector vGMLP-SPh-093 Human FIS1 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-233 Human FIS1 Adenovirus particle


    Target information

    Target ID GM-IP0847
    Target Name FIS1
    Gene ID 51024, 66437, 714444, 288584, 101081944, 479728, 615565, 100059592
    Gene Symbol and Synonyms 2010003O14Rik,CGI-135,FIS1,TTC11
    Uniprot Accession Q9Y3D6
    Uniprot Entry Name FIS1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000214253
    Target Classification Not Available

    The balance between fission and fusion regulates the morphology of mitochondria. TTC11 is a component of a mitochondrial complex that promotes mitochondrial fission (James et al., 2003 [PubMed 12783892]).[supplied by OMIM, Mar 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.