Human CGB/CGB3 ORF/cDNA clone-Adenovirus plasmid (BC022796)

Cat. No.: pGMAP000262
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human CGB/CGB3 adenoviral expression plasmid for CGB adenovirus packaging, CGB adenovirus.

Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.


Target products collection

Go to CG-beta/CGB/CGB3 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMAP000262
Gene Name CGB
Accession Number BC022796
Gene ID 1082
Species Human
Product Type Adenovirus plasmid (overexpression)
Insert Length 498 bp
Gene Alias CGB3
Fluorescent Reporter GFP
Mammalian Cell Selection Null
Fusion Tag 3xflag (C-Terminal)
Promoter EF1
Resistance Kanamycin
ORF Nucleotide Sequence ATGGAGATGTTCCAGGGGCTGCTGCTGTTGCTGCTGCTGAGCATGGGCGGGACATGGGCATCCAAGGAGCCGCTTCGGCCACGGTGCCGCCCCATCAATGCCACCCTGGCTGTGGAGAAGGAGGGCTGCCCCGTGTGCATCACCGTCAACACCACCATCTGTGCCGGCTACTGCCCCACCATGACCCGCGTGCTGCAGGGGGTCCTGCCGGCCCTGCCTCAGGTGGTGTGCAACTACCGCGATGTGCGCTTCGAGTCCATCCGGCTCCCTGGCTGCCCGCGCGGCGTGAACCCCGTGGTCTCCTACGCCGTGGCTCTCAGCTGTCAATGTGCACTCTGCCGCCGCAGCACCACTGACTGCGGGGGTCCCAAGGACCACCCCTTGACCTGTGATGACCCCCGCTTCCAGGACTCCTCTTCCTCAAAGGCCCCTCCCCCGAGCCTTCCAAGTCCATCCCGACTCCCGGGGCCCTCGGACACCCCGATCCTCCCACAATAA
ORF Protein Sequence MEMFQGLLLLLLLSMGGTWASKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYRDVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSSSKAPPPSLPSPSRLPGPSDTPILPQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T06575-Ab Anti-CGB3/ CG-beta/ CGB functional antibody
    Target Antigen GM-Tg-g-T06575-Ag CG-beta/CGB3 protein
    ORF Viral Vector pGMLP000518 Human CGB5 Lentivirus plasmid
    ORF Viral Vector pGMLP000845 Human CGB3 Lentivirus plasmid
    ORF Viral Vector pGMLP001861 Human CGB3 Lentivirus plasmid
    ORF Viral Vector pGMAP000226 Human CGB5 Adenovirus plasmid
    ORF Viral Vector pGMAP000262 Human CGB Adenovirus plasmid
    ORF Viral Vector pGMAP000482 Human CGB5 Adenovirus plasmid
    ORF Viral Vector vGMLP000518 Human CGB5 Lentivirus particle
    ORF Viral Vector vGMLP000845 Human CGB3 Lentivirus particle
    ORF Viral Vector vGMLP001861 Human CGB3 Lentivirus particle
    ORF Viral Vector vGMAP000226 Human CGB5 Adenovirus particle
    ORF Viral Vector vGMAP000262 Human CGB Adenovirus particle
    ORF Viral Vector vGMAP000482 Human CGB5 Adenovirus particle


    Target information

    Target ID GM-T06575
    Target Name CG-beta
    Gene ID 1082
    Gene Symbol and Synonyms CGB,CGB3,CGB5,CGB7,CGB8,hCGB,LHB
    Uniprot Accession P0DN86
    Uniprot Entry Name CGB3_HUMAN
    Protein Sub-location Secreted Protein/Potential Cytokines
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000104827
    Target Classification Not Available

    This gene is a member of the glycoprotein hormone beta chain family and encodes the beta 3 subunit of chorionic gonadotropin (CG). Glycoprotein hormones are heterodimers consisting of a common alpha subunit and an unique beta subunit which confers biological specificity. CG is produced by the trophoblastic cells of the placenta and stimulates the ovaries to synthesize the steroids that are essential for the maintenance of pregnancy. The beta subunit of CG is encoded by 6 genes which are arranged in tandem and inverted pairs on chromosome 19q13.3 and contiguous with the luteinizing hormone beta subunit gene. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.