Human CDC42EP1/BORG5/CEP1 ORF/cDNA clone-Adenovirus plasmid (BC009356)
Cat. No.: pGMAP000532
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human CDC42EP1/BORG5/CEP1 adenoviral expression plasmid for CDC42EP1 adenovirus packaging, CDC42EP1 adenovirus.
Our GM-Adenovirus vector is optimized with the GMVC-modified Adeasy adenovirus packaging system. Find more about the GMVC-modified adenovirus packaging system.
Go to
CDC42EP1/BORG5 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMAP000532 |
Gene Name | CDC42EP1 |
Accession Number | BC009356 |
Gene ID | 11135 |
Species | Human |
Product Type | Adenovirus plasmid (overexpression) |
Insert Length | 1155 bp |
Gene Alias | BORG5,CEP1,MGC15316,MSE55 |
Fluorescent Reporter | GFP |
Mammalian Cell Selection | Null |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | EF1 |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGCCCGGCCCCCAGGGGGGCAGAGGCGCCGCCACCATGAGCCTGGGCAAGCTCTCGCCTGTGGGCTGGGTGTCCAGTTCACAGGGAAAGAGGCGGCTGACTGCAGACATGATCAGCCACCCACTCGGGGACTTCCGCCACACCATGCATGTGGGCCGTGGCGGGGATGTCTTCGGGGACACGTCCTTCCTCAGCAACCACGGTGGCAGCTCCGGGAGCACCCATCGCTCACCCCGCAGCTTCCTGGCCAAGAAGCTGCAGCTGGTGCGGAGGGTGGGGGCGCCCCCCCGGAGGATGGCATCTCCCCCTGCACCCTCCCCGGCTCCACCGGCCATCTCCCCCATCATCAAGAACGCCATCTCCCTGCCCCAGCTCAACCAGGCCGCCTACGACAGCCTCGTGGTTGGCAAGCTCAGCTTCGACAGCAGCCCCACCAGCTCCACGGACGGCCACTCCAGCTACGGCCTGGACTCTGGGTTCTGCACCATCTCCCGCCTGCCCCGCTCGGAAAAGCCGCATGACCGAGACCGGGATGGTTCCTTCCCCTCTGAGCCCGGGCTTCGCCGCTCTGACTCTCTCTTGTCCTTCCGCCTGGACCTCGACCTTGGGCCCTCACTCCTCAGCGAGCTGCTAGGGGTCATGAGCCTGCCAGAAGCCCCTGCAGCTGAGACTCCAGCCCCCGCTGCAAACCCCCCAGCCCCTACTGCAAACCCCACGGGTCCTGCTGCAAACCCCCCAGCCACTACTGCAAACCCCCCAGCACCTGCCGCAACCCCCACGGGTCCTGCTGCAAATCCCCCAGCCCCTGCCGCAAGCTCCACACCCCATGGACACTGTCCCAATGGGGTAACAGCTGGGTTGGGCCCAGTGGCTGAGGTGAAGTCCAGCCCAGTGGGAGGGGGTCCCCGAGGACCTGCTGGCCCTGCCCTCGGCAGGCACTGGGGAGCAGGCTGGGATGGCGGCCACCACTACCCAGAGATGGATGCGCGGCAGGAGCGGGTGGAGGTGCTGCCCCAAGCCCGGGCCTCCTGGGAGAGCCTGGACGAAGAGTGGAGGGCGCCCCAGGCAGGCAGCAGGACCCCAGTGCCCAGCACAGTGCAAGCAAACACCTTTGAATTTGCGGATGCTGAGGAGGATGATGAGGTCAAGGTGTGA |
ORF Protein Sequence | MPGPQGGRGAATMSLGKLSPVGWVSSSQGKRRLTADMISHPLGDFRHTMHVGRGGDVFGDTSFLSNHGGSSGSTHRSPRSFLAKKLQLVRRVGAPPRRMASPPAPSPAPPAISPIIKNAISLPQLNQAAYDSLVVGKLSFDSSPTSSTDGHSSYGLDSGFCTISRLPRSEKPHDRDRDGSFPSEPGLRRSDSLLSFRLDLDLGPSLLSELLGVMSLPEAPAAETPAPAANPPAPTANPTGPAANPPATTANPPAPAATPTGPAANPPAPAASSTPHGHCPNGVTAGLGPVAEVKSSPVGGGPRGPAGPALGRHWGAGWDGGHHYPEMDARQERVEVLPQARASWESLDEEWRAPQAGSRTPVPSTVQANTFEFADAEEDDEVKV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-MP2043-Ab | Anti-BORG5/ CDC42EP1/ CEP1 monoclonal antibody |
Target Antigen | GM-Tg-g-MP2043-Ag | CDC42EP1 VLP (virus-like particle) |
ORF Viral Vector | pGMAP000532 | Human CDC42EP1 Adenovirus plasmid |
ORF Viral Vector | vGMAP000532 | Human CDC42EP1 Adenovirus particle |
Target information
Target ID | GM-MP2043 |
Target Name | CDC42EP1 |
Gene ID | 11135, 104445, 697553, 315121, 101097658, 481267, 511099, 100054751 |
Gene Symbol and Synonyms | 1810058K22Rik,BORG5,CDC42EP1,CEP1,MSE55 |
Uniprot Accession | Q00587 |
Uniprot Entry Name | BORG5_HUMAN |
Protein Sub-location | Transmembrane Protein |
Category | Not Available |
Disease | Not Available |
Gene Ensembl | ENSG00000128283 |
Target Classification | Not Available |
CDC42 is a member of the Rho GTPase family that regulates multiple cellular activities, including actin polymerization. The protein encoded by this gene is a CDC42 binding protein that mediates actin cytoskeleton reorganization at the plasma membrane. This protein is secreted and is primarily found in bone marrow. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.