Human SLC35C2/BA394O2.1/C20orf5 ORF/cDNA clone-Lentivirus plasmid (NM_173179)

Cat. No.: pGMLV001409
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days

Pre-made Human SLC35C2/BA394O2.1/C20orf5 Lentiviral expression plasmid for SLC35C2 lentivirus packaging, SLC35C2 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.

pdf Datasheet
pdf MSDS
pdf Terms of Use
Target products collection

Go to SLC35C2/BA394O2.1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Purchase
Total Price: $607.44
Shipping fee: Limited-time free
For payment issues, contact us.


Product Description

Catalog ID pGMLV001409
Gene Name SLC35C2
Accession Number NM_173179
Gene ID 51006
Species Human
Product Type Lentivirus plasmid (overexpression)
Insert Length 1098 bp
Gene Alias BA394O2.1,C20orf5,CGI-15,OVCOV1
Fluorescent Reporter Null
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGGGAGGTGGGCCCTCGATGTGGCCTTTTTGTGGAAGGCGGTGTTGACCCTGGGGCTGGTGCTTCTCTACTACTGCTTCTCCATCGGCATCACCTTCTACAACAAGTGGCTGACAAAGAGCTTCCATTTCCCCCTCTTCATGACGATGCTGCACCTGGCCGTGATCTTCCTCTTCTCCGCCCTGTCCAGGGCGCTGGTTCAGTGCTCCAGCCACAGGGCCCGTGTGGTGCTGAGCTGGGCCGACTACCTCAGAAGAGTGGCTCCCACAGCTCTGGCGACGGCGCTTGACGTGGGCTTGTCCAACTGGAGCTTCCTGTATGTCACCGTCTCGCTGTACACAATGACCAAATCCTCAGCTGTCCTCTTCATCTTGATCTTCTCTCTGATCTTCAAGCTGGAGGAGCTGCGCGCGGCACTGGTCCTGGTGGTCCTCCTCATCGCCGGGGGTCTCTTCATGTTCACCTACAAGTCCACACAGTTCAACGTGGAGGGCTTCGCCTTGGTGCTGGGGGCCTCGTTCATCGGTGGCATTCGCTGGACCCTCACCCAGATGCTCCTGCAGAAGGCTGAACTCGGCCTCCAGAATCCCATCGACACCATGTTCCACCTGCAGCCACTCATGTTCCTGGGGCTCTTCCCTCTCTTTGCTGTATTTGAAGGTCTCCATTTGTCCACATCTGAGAAAATCTTCCGTTTCCAGGACACAGGGCTGCTCCTGCGGGTACTTGGGAGCCTCTTCCTTGGCGGGATTCTCGCCTTTGGTTTGGGCTTCTCTGAGTTCCTCCTGGTCTCCAGAACCTCCAGCCTCACTCTCTCCATTGCCGGCATTTTTAAGGAAGTCTGCACTTTGCTGTTGGCAGCTCATCTGCTGGGCGATCAGATCAGCCTCCTGAACTGGCTGGGCTTCGCCCTCTGCCTCTCGGGAATATCCCTCCACGTTGCCCTCAAAGCCCTGCATTCCAGAGGTGATGGTGGCCCCAAGGCCTTGAAGGGGCTGGGCTCCAGCCCCGACCTGGAGCTGCTGCTCCGGAGCAGCCAGCGGGAGGAAGGTGACAATGAGGAGGAGGAGTACTTTGTGGCCCAGGGGCAGCAGTGA
ORF Protein Sequence MGRWALDVAFLWKAVLTLGLVLLYYCFSIGITFYNKWLTKSFHFPLFMTMLHLAVIFLFSALSRALVQCSSHRARVVLSWADYLRRVAPTALATALDVGLSNWSFLYVTVSLYTMTKSSAVLFILIFSLIFKLEELRAALVLVVLLIAGGLFMFTYKSTQFNVEGFALVLGASFIGGIRWTLTQMLLQKAELGLQNPIDTMFHLQPLMFLGLFPLFAVFEGLHLSTSEKIFRFQDTGLLLRVLGSLFLGGILAFGLGFSEFLLVSRTSSLTLSIAGIFKEVCTLLLAAHLLGDQISLLNWLGFALCLSGISLHVALKALHSRGDGGPKALKGLGSSPDLELLLRSSQREEGDNEEEEYFVAQGQQ

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1710-Ab Anti-SLC35C2 monoclonal antibody
    Target Antigen GM-Tg-g-IP1710-Ag SLC35C2 protein
    ORF Viral Vector pGMLV001409 Human SLC35C2 Lentivirus plasmid
    ORF Viral Vector vGMLV001409 Human SLC35C2 Lentivirus particle


    Target information

    Target ID GM-IP1710
    Target Name SLC35C2
    Gene ID 51006, 228875, 707438, 311637, 101083504, 609863, 514485, 100056733
    Gene Symbol and Synonyms BA394O2.1,C20orf5,CGI-15,D2Wsu58e,OVCOV1,SLC35C2
    Uniprot Accession Q9NQQ7
    Uniprot Entry Name S35C2_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Prostate Cancer
    Gene Ensembl ENSG00000080189
    Target Classification Not Available

    This gene encodes a member of the triose-phosphate transporter protein family. This gene is regulated by oxygen tension, is induced in hypoxic trophoblast cells, and is overexpressed in ovarian cancer. Alternative splicing results in multiple transcript variants. A pseudogene of this gene has been defined on the X chromosome. [provided by RefSeq, Jul 2013]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.