Human RTN3/ASYIP/HAP ORF/cDNA clone-Lentivirus plasmid (NM_201430.3)
Cat. No.: pGMLV001819
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human RTN3/ASYIP/HAP Lentiviral expression plasmid for RTN3 lentivirus packaging, RTN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
RTN3/ASYIP products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
| Catalog ID | pGMLV001819 |
| Gene Name | RTN3 |
| Accession Number | NM_201430.3 |
| Gene ID | 10313 |
| Species | Human |
| Product Type | Lentivirus plasmid (overexpression) |
| Insert Length | 726 bp |
| Gene Alias | ASYIP,HAP,NSPL2,NSPLII,RTN3-A1 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | MYC (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGTGCACGATCTGATTTTCTGGAGAGATGTGAAGAAGACTGGGTTTGTCTTTGGCACCACGCTGATCATGCTGCTTTCCCTGGCAGCTTTCAGTGTCATCAGTGTGGTTTCTTACCTCATCCTGGCTCTTCTCTCTGTCACCATCAGCTTCAGGATCTACAAGTCCGTCATCCAAGCTGTACAGAAGTCAGAAGAAGGCCATCCATTCAAAGCCTACCTGGACGTAGACATTACTCTGTCCTCAGAAGCTTTCCATAATTACATGAATGCTGCCATGGTGCACATCAACAGGGCCCTGAAACTCATTATTCGTCTCTTTCTGGTAGAAGATCTGGTTGACTCCTTGAAGCTGGCTGTCTTCATGTGGCTGATGACCTATGTTGGTGCTGTTTTTAACGGAATCACCCTTCTAATTCTTGCTGAACTGCTCATTTTCAGTGTCCCGATTGTCTATGAGAAGTACAAGGATCCAAGCAAAACTCCCTGGAATCGCCAAAAAAAAGGCAGAATAAGTACATGGAAACCAGAAATGCAACAGTTACTAAAACACCATTTAATAGTTATAACGTCGTTACTTGTACTATGA |
| ORF Protein Sequence | MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKDPSKTPWNRQKKGRISTWKPEMQQLLKHHLIVITSLLVL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-MP1470-Ab | Anti-RTN3/ ASYIP/ HAP monoclonal antibody |
| Target Antigen | GM-Tg-g-MP1470-Ag | RTN3 VLP (virus-like particle) |
| ORF Viral Vector | pGMLV001819 | Human RTN3 Lentivirus plasmid |
| ORF Viral Vector | vGMLV001819 | Human RTN3 Lentivirus particle |
Target information
| Target ID | GM-MP1470 |
| Target Name | RTN3 |
| Gene ID | 10313, 20168, 718173, 140945, 101094953, 476043, 359721, 100054417 |
| Gene Symbol and Synonyms | ASYIP,HAP,NSPL2,NSPLII,RTN3,RTN3-A1,RTN3w |
| Uniprot Accession | O95197 |
| Uniprot Entry Name | RTN3_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Not Available |
| Disease | Not Available |
| Gene Ensembl | ENSG00000133318 |
| Target Classification | Not Available |
This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


