Human RTN3/ASYIP/HAP ORF/cDNA clone-Lentivirus particle (NM_201430.3)

Cat. No.: vGMLV001819

Pre-made Human RTN3/ASYIP/HAP Lentiviral expression plasmid for RTN3 lentivirus packaging, RTN3 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to RTN3/ASYIP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLV001819 Human RTN3 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLV001819
Gene Name RTN3
Accession Number NM_201430.3
Gene ID 10313
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 726 bp
Gene Alias ASYIP,HAP,NSPL2,NSPLII,RTN3-A1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag MYC (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGGCGGAGCCGTCGGCGGCCACTCAGTCCCATTCCATCTCCTCGTCGTCCTTCGGAGCCGAGCCGTCCGCGCCCGGCGGCGGCGGGAGCCCAGGAGCCTGCCCCGCCCTGGGGACGAAGAGCTGCAGCTCCTCCTGTGCGGTGCACGATCTGATTTTCTGGAGAGATGTGAAGAAGACTGGGTTTGTCTTTGGCACCACGCTGATCATGCTGCTTTCCCTGGCAGCTTTCAGTGTCATCAGTGTGGTTTCTTACCTCATCCTGGCTCTTCTCTCTGTCACCATCAGCTTCAGGATCTACAAGTCCGTCATCCAAGCTGTACAGAAGTCAGAAGAAGGCCATCCATTCAAAGCCTACCTGGACGTAGACATTACTCTGTCCTCAGAAGCTTTCCATAATTACATGAATGCTGCCATGGTGCACATCAACAGGGCCCTGAAACTCATTATTCGTCTCTTTCTGGTAGAAGATCTGGTTGACTCCTTGAAGCTGGCTGTCTTCATGTGGCTGATGACCTATGTTGGTGCTGTTTTTAACGGAATCACCCTTCTAATTCTTGCTGAACTGCTCATTTTCAGTGTCCCGATTGTCTATGAGAAGTACAAGGATCCAAGCAAAACTCCCTGGAATCGCCAAAAAAAAGGCAGAATAAGTACATGGAAACCAGAAATGCAACAGTTACTAAAACACCATTTAATAGTTATAACGTCGTTACTTGTACTATGA
ORF Protein Sequence MAEPSAATQSHSISSSSFGAEPSAPGGGGSPGACPALGTKSCSSSCAVHDLIFWRDVKKTGFVFGTTLIMLLSLAAFSVISVVSYLILALLSVTISFRIYKSVIQAVQKSEEGHPFKAYLDVDITLSSEAFHNYMNAAMVHINRALKLIIRLFLVEDLVDSLKLAVFMWLMTYVGAVFNGITLLILAELLIFSVPIVYEKYKDPSKTPWNRQKKGRISTWKPEMQQLLKHHLIVITSLLVL

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP1470-Ab Anti-RTN3/ ASYIP/ HAP monoclonal antibody
    Target Antigen GM-Tg-g-MP1470-Ag RTN3 VLP (virus-like particle)
    ORF Viral Vector pGMLV001819 Human RTN3 Lentivirus plasmid
    ORF Viral Vector vGMLV001819 Human RTN3 Lentivirus particle


    Target information

    Target ID GM-MP1470
    Target Name RTN3
    Gene ID 10313, 20168, 718173, 140945, 101094953, 476043, 359721, 100054417
    Gene Symbol and Synonyms ASYIP,HAP,NSPL2,NSPLII,RTN3,RTN3-A1,RTN3w
    Uniprot Accession O95197
    Uniprot Entry Name RTN3_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000133318
    Target Classification Not Available

    This gene belongs to the reticulon family of highly conserved genes that are preferentially expressed in neuroendocrine tissues. This family of proteins interact with, and modulate the activity of beta-amyloid converting enzyme 1 (BACE1), and the production of amyloid-beta. An increase in the expression of any reticulon protein substantially reduces the production of amyloid-beta, suggesting that reticulon proteins are negative modulators of BACE1 in cells. Alternatively spliced transcript variants encoding different isoforms have been found for this gene, and pseudogenes of this gene are located on chromosomes 4 and 12. [provided by RefSeq, May 2012]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.