Human CXCL10/C7/crg-2 ORF/cDNA clone-Adenovirus particle (BC010954)
Cat. No.: vGMAP000053
Pre-made Human CXCL10/C7/crg-2 Adenovirus for CXCL10 overexpression in-vitro and in-vivo. The CXCL10 adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified CXCL10-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
CXCL10/C7 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000053 | Human CXCL10 Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000053 |
| Gene Name | CXCL10 |
| Accession Number | BC010954 |
| Gene ID | 3627 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 297 bp |
| Gene Alias | C7,crg-2,gIP-10,IFI10,IP-10,mob-1 |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGAATCAAACTGCCATTCTGATTTGCTGCCTTATCTTTCTGACTCTAAGTGGCATTCAAGGAGTACCTCTCTCTAGAACTGTACGCTGTACCTGCATCAGCATTAGTAATCAACCTGTTAATCCAAGGTCTTTAGAAAAACTTGAAATTATTCCTGCAAGCCAATTTTGTCCACGTGTTGAGATCATTGCTACAATGAAAAAGAAGGGTGAGAAGAGATGTCTGAATCCAGAATCGAAGGCCATCAAGAATTTACTGAAAGCAGTTAGCAAGGAAAGGTCTAAAAGATCTCCTTAA |
| ORF Protein Sequence | MNQTAILICCLIFLTLSGIQGVPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Biosimilar | GMP-Bios-ab-168 | Pre-Made Eldelumab biosimilar, Whole mAb, Anti-CXCL10 Antibody: Anti-C7/IFI10/INP10/IP-10/SCYB10/crg-2/gIP-10/mob-1 therapeutic antibody |
| Target Antibody | GM-Tg-g-T30635-Ab | Anti-CXL10/ CXCL10/ C7 functional antibody |
| Target Antigen | GM-Tg-g-T30635-Ag | CXCL10 protein |
| Cytokine | cks-Tg-g-GM-T30635 | chemokine (C-X-C motif) ligand 10 (CXCL10) protein & antibody |
| ORF Viral Vector | pGMLP001931 | Human CXCL10 Lentivirus plasmid |
| ORF Viral Vector | pGMAP000053 | Human CXCL10 Adenovirus plasmid |
| ORF Viral Vector | vGMLP001931 | Human CXCL10 Lentivirus particle |
| ORF Viral Vector | vGMAP000053 | Human CXCL10 Adenovirus particle |
Target information
| Target ID | GM-T30635 |
| Target Name | CXCL10 |
| Gene ID | 3627, 574243, 245920, 101100131, 478432, 615107, 100050993 |
| Gene Symbol and Synonyms | C7,crg-2,CXCL10,gIP-10,IFI10,INP10,IP-10,mob-1,SCYB10 |
| Uniprot Accession | P02778 |
| Uniprot Entry Name | CXL10_HUMAN |
| Protein Sub-location | Secreted Protein/Potential Cytokines |
| Category | Therapeutics Target, INN Index, Cytokine Target |
| Disease | Breast Cancer, Complications of kidney transplant, Bacterial sepsis of newborn, Acute kidney failure |
| Gene Ensembl | ENSG00000169245 |
| Target Classification | Not Available |
This antimicrobial gene encodes a chemokine of the CXC subfamily and ligand for the receptor CXCR3. Binding of this protein to CXCR3 results in pleiotropic effects, including stimulation of monocytes, natural killer and T-cell migration, and modulation of adhesion molecule expression. This gene may also be a key regulator of the 'cytokine storm' immune response to SARS-CoV-2 infection. [provided by RefSeq, Sep 2020]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


