Human TGFA/TFGA ORF/cDNA clone-Adenovirus particle (BC005308)
Cat. No.: vGMAP000120
Pre-made Human TGFA/TFGA Adenovirus for TGFA overexpression in-vitro and in-vivo. The TGFA adenoviral vector excels as a vehicle for transient gene transfection in both stable cell lines and primary cells, including DC cells, macrophages, cardiomyocytes, hepatocytes, and neurons. The purified TGFA-encoding adenovirus also stands out as a quintessential tool for in vivo studies and vaccine research initiatives.
At GM Vector Core (GMVC), we provide bespoke adenovirus development and manufacture various grades of adenoviruses utilizing cutting-edge techniques. Dive deeper into our offerings.
Go to
TGFA/TFGA products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product information
| Catalog No. | Product Name | Adenovirus Grade | Adenovirus quantity |
| vGMAP000120 | Human TGFA Adenovirus particle | Research Grade-In vitro | 1E+10PFU (1E+10pfu/ml×1ml) |
| 5E+10PFU (1E+10pfu/ml×5ml) | |||
| 1E+11PFU (1E+10pfu/ml×10ml) | |||
| Research Grade-In vivo | 1E+11PFU (1E+11pfu/ml×1ml) | ||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMAP000120 |
| Gene Name | TGFA |
| Accession Number | BC005308 |
| Gene ID | 7039 |
| Species | Human |
| Product Type | Adenovirus particle (overexpression) |
| Insert Length | 480 bp |
| Gene Alias | TFGA |
| Fluorescent Reporter | GFP |
| Mammalian Cell Selection | Null |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | EF1 |
| Resistance | Kanamycin |
| ORF Nucleotide Sequence | ATGGTCCCCTCGGCTGGACAGCTCGCCCTGTTCGCTCTGGGTATTGTGTTGGCTGCGTGCCAGGCCTTGGAGAACAGCACGTCCCCGCTGAGTGACCCGCCCGTGGCTGCAGCAGTGGTGTCCCATTTTAATGACTGCCCAGATTCCCACACTCAGTTCTGCTTCCATGGAACCTGCAGGTTTTTGGTGCAGGAGGACAAGCCAGCATGTGTCTGCCATTCTGGGTACGTTGGTGCACGCTGTGAGCATGCGGACCTCCTGGCCGTGGTGGCTGCCAGCCAGAAGAAGCAGGCCATCACCGCCTTGGTGGTGGTCTCCATCGTGGCCCTGGCTGTCCTTATCATCACATGTGTGCTGATACACTGCTGCCAGGTCCGAAAACACTGTGAGTGGTGCCGGGCCCTCATCTGCCGGCACGAGAAGCCCAGCGCCCTCCTGAAGGGAAGAACCGCTTGCTGCCACTCAGAAACAGTGGTCTGA |
| ORF Protein Sequence | MVPSAGQLALFALGIVLAACQALENSTSPLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLIHCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETVV |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T00033-Ab | Anti-TGFA/ TFGA monoclonal antibody |
| Target Antigen | GM-Tg-g-T00033-Ag | TGFA VLP (virus-like particle) |
| Cytokine | cks-Tg-g-GM-T00033 | transforming growth factor, alpha (TGFA) protein & antibody |
| ORF Viral Vector | pGMLP000405 | Human TGFA Lentivirus plasmid |
| ORF Viral Vector | pGMAP000120 | Human TGFA Adenovirus plasmid |
| ORF Viral Vector | vGMLP000405 | Human TGFA Lentivirus particle |
| ORF Viral Vector | vGMAP000120 | Human TGFA Adenovirus particle |
Target information
| Target ID | GM-T00033 |
| Target Name | TGFA |
| Gene ID | 7039, 21802, 613031, 24827, 101094921, 403431, 540388, 100060423 |
| Gene Symbol and Synonyms | RATTGFAA,TFGA,TGF alpha,TGFA,TGFAA,wa-1,wa1 |
| Uniprot Accession | P01135 |
| Uniprot Entry Name | TGFA_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Cytokine Target |
| Disease | cancer patients |
| Gene Ensembl | ENSG00000163235 |
| Target Classification | Not Available |
This gene encodes a growth factor that is a ligand for the epidermal growth factor receptor, which activates a signaling pathway for cell proliferation, differentiation and development. This protein may act as either a transmembrane-bound ligand or a soluble ligand. This gene has been associated with many types of cancers, and it may also be involved in some cases of cleft lip/palate. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Sep 2011]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


