Human PSCA/PRO232 ORF/cDNA clone-Lentivirus particle (NM_005672)
Cat. No.: vGMLP001836
Pre-made Human PSCA/PRO232 Lentiviral expression plasmid for PSCA lentivirus packaging, PSCA lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.
Go to
PSCA/PRO232 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
| Catalog No. | Product Name | lentivirus Grade | lentivirus quantity |
|---|---|---|---|
| vGMLP001836 | Human PSCA Lentivirus particle | Pilot Grade | 1.0E+8TU |
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| Research Grade | 1.0E+8TU | ||
| 5.0E+8TU | |||
| 1.0E+9TU | |||
| GMP-like Grade | inquiry | ||
| GMP Grade | inquiry |
Product Description
| Catalog ID | vGMLP001836 |
| Gene Name | PSCA |
| Accession Number | NM_005672 |
| Gene ID | 8000 |
| Species | Human |
| Product Type | Lentivirus particle (overexpression) |
| Insert Length | 345 bp |
| Gene Alias | PRO232 |
| Fluorescent Reporter | ZsGreen |
| Mammalian Cell Selection | Puromyocin |
| Fusion Tag | 3xflag (C-Terminal) |
| Promoter | CMV |
| Resistance | Amplicin |
| ORF Nucleotide Sequence | ATGGCAGGCTTGGCCCTGCAGCCAGGCACTGCCCTGCTGTGCTACTCCTGCAAAGCCCAGGTGAGCAACGAGGACTGCCTGCAGGTGGAGAACTGCACCCAGCTGGGGGAGCAGTGCTGGACCGCGCGCATCCGCGCAGTTGGCCTCCTGACCGTCATCAGCAAAGGCTGCAGCTTGAACTGCGTGGATGACTCACAGGACTACTACGTGGGCAAGAAGAACATCACGTGCTGTGACACCGACTTGTGCAACGCCAGCGGGGCCCATGCCCTGCAGCCGGCTGCTGCCATCCTTGCGCTGCTCCCTGCACTCGGCCTGCTGCTCTGGGGACCCGGCCAGCTCTAG |
| ORF Protein Sequence | MAGLALQPGTALLCYSCKAQVSNEDCLQVENCTQLGEQCWTARIRAVGLLTVISKGCSLNCVDDSQDYYVGKKNITCCDTDLCNASGAHALQPAAAILALLPALGLLLWGPGQL |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
| Category | Cat No. | Products Name |
|---|---|---|
| Target Antibody | GM-Tg-g-T23953-Ab | Anti-PSCA/ PRO232 monoclonal antibody |
| Target Antigen | GM-Tg-g-T23953-Ag | PSCA VLP (virus-like particle) |
| ORF Viral Vector | pGMLP000992 | Human PSCA Lentivirus plasmid |
| ORF Viral Vector | pGMLP001836 | Human PSCA Lentivirus plasmid |
| ORF Viral Vector | vGMLP000992 | Human PSCA Lentivirus particle |
| ORF Viral Vector | vGMLP001836 | Human PSCA Lentivirus particle |
Target information
| Target ID | GM-T23953 |
| Target Name | PSCA |
| Gene ID | 8000, 72373, 703505, 680210, 101097300, 482068, 100298702, 100063721 |
| Gene Symbol and Synonyms | 2210408B04Rik,lncPSCA,PRO232,PSCA |
| Uniprot Accession | O43653 |
| Uniprot Entry Name | PSCA_HUMAN |
| Protein Sub-location | Transmembrane Protein |
| Category | Therapeutics Target, Immuno-oncology Target |
| Disease | Prostate Cancer, Type 2 diabetes mellitus with diabetic nephropathy |
| Gene Ensembl | ENSG00000167653 |
| Target Classification | Checkpoint-Immuno Oncology |
This gene encodes a glycosylphosphatidylinositol-anchored cell membrane glycoprotein. In addition to being highly expressed in the prostate it is also expressed in the bladder, placenta, colon, kidney, and stomach. This gene is up-regulated in a large proportion of prostate cancers and is also detected in cancers of the bladder and pancreas. This gene includes a polymorphism that results in an upstream start codon in some individuals; this polymorphism is thought to be associated with a risk for certain gastric and bladder cancers. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Feb 2010]
About GMVC

GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.


