Human PNOC/N/OFQ/NOP ORF/cDNA clone-Lentivirus particle (NM_006228)

Cat. No.: vGMLP003008

Pre-made Human PNOC/N/OFQ/NOP Lentiviral expression plasmid for PNOC lentivirus packaging, PNOC lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to PNOC/N/OFQ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003008 Human PNOC Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003008
Gene Name PNOC
Accession Number NM_006228
Gene ID 5368
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 531 bp
Gene Alias N/OFQ,NOP,OFQ,ppN/OFQ,PPNOC
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAAAGTCCTGCTTTGTGACCTGCTGCTGCTCAGTCTCTTCTCCAGTGTGTTCAGCAGTTGTCAGAGGGACTGTCTCACATGCCAGGAGAAGCTCCACCCAGCCCTGGACAGCTTCGACCTGGAGGTGTGCATCCTCGAGTGTGAAGAGAAGGTCTTCCCCAGCCCCCTCTGGACTCCATGCACCAAGGTCATGGCCAGGAGCTCTTGGCAGCTCAGCCCTGCCGCCCCAGAGCATGTGGCGGCTGCTCTCTACCAGCCGAGAGCTTCGGAGATGCAGCATCTGCGGCGAATGCCCCGAGTCCGGAGCTTGTTCCAGGAGCAGGAAGAGCCCGAGCCTGGCATGGAGGAGGCTGGTGAGATGGAGCAGAAGCAGCTGCAGAAGAGATTTGGGGGCTTCACCGGGGCCCGGAAGTCGGCCAGGAAGTTGGCCAATCAGAAGCGGTTCAGTGAGTTTATGAGGCAATACTTGGTCCTGAGCATGCAGTCCAGCCAGCGCCGGCGCACCCTGCACCAGAATGGTAATGTGTAG
ORF Protein Sequence MKVLLCDLLLLSLFSSVFSSCQRDCLTCQEKLHPALDSFDLEVCILECEEKVFPSPLWTPCTKVMARSSWQLSPAAPEHVAAALYQPRASEMQHLRRMPRVRSLFQEQEEPEPGMEEAGEMEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNV

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-MP2561-Ab Anti-PNOC/ N/OFQ/ NOP monoclonal antibody
    Target Antigen GM-Tg-g-MP2561-Ag PNOC VLP (virus-like particle)
    ORF Viral Vector pGMLP003008 Human PNOC Lentivirus plasmid
    ORF Viral Vector vGMLP003008 Human PNOC Lentivirus particle


    Target information

    Target ID GM-MP2561
    Target Name PNOC
    Gene ID 5368, 18155, 713633, 25516, 101094754, 486095, 281414, 100061049
    Gene Symbol and Synonyms N/OFQ,N23K,Nociceptin,NOP,Npnc1,OFQ,OFQ/N,PNOC,ppN/OFQ,PPNOC
    Uniprot Accession Q13519
    Uniprot Entry Name PNOC_HUMAN
    Protein Sub-location Transmembrane Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000168081
    Target Classification Not Available

    This gene encodes a preproprotein that is proteolytically processed to generate multiple protein products. These products include nociceptin, nocistatin, and orphanin FQ2 (OFQ2). Nociceptin, also known as orphanin FQ, is a 17-amino acid neuropeptide that binds to the nociceptin receptor to induce increased pain sensitivity, and may additionally regulate body temperature, learning and memory, and hunger. Another product of the encoded preproprotein, nocistatin, may inhibit the effects of nociceptin. [provided by RefSeq, Jul 2015]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.