Human SRD5A1/S5AR 1 ORF/cDNA clone-Lentivirus particle (NM_001324323)

Cat. No.: vGMLP003302

Pre-made Human SRD5A1/S5AR 1 Lentiviral expression plasmid for SRD5A1 lentivirus packaging, SRD5A1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to SRD5A1/S5AR 1 products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003302 Human SRD5A1 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003302
Gene Name SRD5A1
Accession Number NM_001324323
Gene ID 6715
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 561 bp
Gene Alias S5AR 1
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGACTTTACCCTGGCGCACATGGTCAGAATGGAAACAAATAACAAGCTTTACAGTTTTTCCTGCTCTATTAAGGTGCTTAATTTACCCATTTCTGATGCGAGGAGGAAAGCCTATGCCACTGTTGGCGTGTACAATGGCGATTATGTTCTGTACCTGTAACGGCTATTTGCAAAGCAGATACTTGAGCCATTGTGCAGTGTATGCTGATGACTGGGTAACAGATCCCCGTTTTCTAATAGGTTTTGGCTTGTGGTTAACGGGCATGTTGATAAACATCCATTCAGATCATATCCTAAGGAATCTCAGAAAACCAGGAGATACTGGATACAAAATACCAAGGGGAGGCTTATTTGAATACGTAACTGCAGCCAACTATTTTGGAGAAATCATGGAGTGGTGTGGCTATGCCCTGGCCAGCTGGTCTGTCCAAGGCGCGGCTTTTGCTTTCTTCACGTTTTGTTTTTTATCTGGTAGAGCAAAAGAGCATCATGAGTGGTACCTCCGGAAATTTGAAGAGTATCCAAAGTTCAGAAAAATTATAATTCCATTTTTGTTTTAA
ORF Protein Sequence MTLPWRTWSEWKQITSFTVFPALLRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAVYADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYALASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP0056-Ab Anti-SRD5A1 monoclonal antibody
    Target Antigen GM-Tg-g-IP0056-Ag SRD5A1 protein
    ORF Viral Vector pGMLP003302 Human SRD5A1 Lentivirus plasmid
    ORF Viral Vector pGMLP004030 Human SRD5A1 Lentivirus plasmid
    ORF Viral Vector vGMLP003302 Human SRD5A1 Lentivirus particle
    ORF Viral Vector vGMLP004030 Human SRD5A1 Lentivirus particle


    Target information

    Target ID GM-IP0056
    Target Name SRD5A1
    Gene ID 6715, 78925, 695103, 24950, 101098848, 403716, 614612, 100071450
    Gene Symbol and Synonyms 0610031P22Rik,4930435F02Rik,S5AR 1,Srd5a-1,SRD5A1
    Uniprot Accession P18405
    Uniprot Entry Name S5A1_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target
    Disease Not Available
    Gene Ensembl ENSG00000145545
    Target Classification Not Available

    Steroid 5-alpha-reductase (EC 1.3.99.5) catalyzes the conversion of testosterone into the more potent androgen, dihydrotestosterone (DHT). Also see SRD5A2 (MIM 607306).[supplied by OMIM, Mar 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.