Human TMEM134 ORF/cDNA clone-Lentivirus particle (NM_001078650)

Cat. No.: vGMLP003345

Pre-made Human TMEM134/ Lentiviral expression plasmid for TMEM134 lentivirus packaging, TMEM134 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to TMEM134/ products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

pdf MSDS
pdf Datasheet

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP003345 Human TMEM134 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP003345
Gene Name TMEM134
Accession Number NM_001078650
Gene ID 80194
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 543 bp
Gene Alias
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGAGCGCCGCCCGGCCCCAGTTCAGCATTGATGATGCCTTCGAGCTGTCCCTGGAGGACGGGGGCCCTGGGCCCGAGTCCAGCGGGGTCGCGCGCTTTGGGCCGCTGCACTTCGAGCGTCGGGCCCGGTTCGAGGTGGCTGACGAGGACAAGCAGTCCCGGCTGCGCTACCAGAACCTGGAGAACGATGAGGATGGAGCCCAGGCCTCTCCGGAGCCGGATGGGGGAGTCGGCACCAGGGATTCCAGCCGAACTTCCATCCGCAGCTCCCAGTGGTCCTTCAGCACCATCAGCAGCAGCACCCAGCGCTCCTACAACACCTGCTGCAGCTGGACCCAACACCCTTTGATCCAGAAGAACCGCCGAGTGGTGCTGGCCTCCTTCCTGCTCCTGCTGCTGGGGCTGGGTGTCTCCAGCGCCATCTTCTTCGTGCCGGGCTTCCTGTTGTTGGTGCCTGGAGTCTATCACGTGATCTTCATCTACTGCGCGGTCAAGGGCCACCGGGGCTTCCAGTTCTTCTACCTGCCCTACTTCGAGAAGTGA
ORF Protein Sequence MSAARPQFSIDDAFELSLEDGGPGPESSGVARFGPLHFERRARFEVADEDKQSRLRYQNLENDEDGAQASPEPDGGVGTRDSSRTSIRSSQWSFSTISSSTQRSYNTCCSWTQHPLIQKNRRVVLASFLLLLLGLGVSSAIFFVPGFLLLVPGVYHVIFIYCAVKGHRGFQFFYLPYFEK

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-IP1979-Ab Anti-TMEM134 monoclonal antibody
    Target Antigen GM-Tg-g-IP1979-Ag TMEM134 protein
    ORF Viral Vector pGMLP003345 Human TMEM134 Lentivirus plasmid
    ORF Viral Vector vGMLP003345 Human TMEM134 Lentivirus particle


    Target information

    Target ID GM-IP1979
    Target Name TMEM134
    Gene ID 80194, 66990, 711894, 361695, 101081673, 610471, 510129, 100147448
    Gene Symbol and Synonyms 2410001H17Rik,RGD1305824,TMEM134
    Uniprot Accession Q9H6X4
    Uniprot Entry Name TM134_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Not Available
    Disease Not Available
    Gene Ensembl ENSG00000172663
    Target Classification Not Available

    Located in cytosol and perinuclear region of cytoplasm. [provided by Alliance of Genome Resources, Apr 2022]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.