Human HMOX1/bK286B10/HMOX1D ORF/cDNA clone-Lentivirus plasmid (NM_002133.2)
Cat. No.: pGMLV000302
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human HMOX1/bK286B10/HMOX1D Lentiviral expression plasmid for HMOX1 lentivirus packaging, HMOX1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
HMOX1/bK286B10 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000302 |
Gene Name | HMOX1 |
Accession Number | NM_002133.2 |
Gene ID | 3162 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 867 bp |
Gene Alias | bK286B10,HMOX1D,HO-1,HSP32 |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGAGCGTCCGCAACCCGACAGCATGCCCCAGGATTTGTCAGAGGCCCTGAAGGAGGCCACCAAGGAGGTGCACACCCAGGCAGAGAATGCTGAGTTCATGAGGAACTTTCAGAAGGGCCAGGTGACCCGAGACGGCTTCAAGCTGGTGATGGCCTCCCTGTACCACATCTATGTGGCCCTGGAGGAGGAGATTGAGCGCAACAAGGAGAGCCCAGTCTTCGCCCCTGTCTACTTCCCAGAAGAGCTGCACCGCAAGGCTGCCCTGGAGCAGGACCTGGCCTTCTGGTACGGGCCCCGCTGGCAGGAGGTCATCCCCTACACACCAGCCATGCAGCGCTATGTGAAGCGGCTCCACGAGGTGGGGCGCACAGAGCCCGAGCTGCTGGTGGCCCACGCCTACACCCGCTACCTGGGTGACCTGTCTGGGGGCCAGGTGCTCAAAAAGATTGCCCAGAAAGCCCTGGACCTGCCCAGCTCTGGCGAGGGCCTGGCCTTCTTCACCTTCCCCAACATTGCCAGTGCCACCAAGTTCAAGCAGCTCTACCGCTCCCGCATGAACTCCCTGGAGATGACTCCCGCAGTCAGGCAGAGGGTGATAGAAGAGGCCAAGACTGCGTTCCTGCTCAACATCCAGCTCTTTGAGGAGTTGCAGGAGCTGCTGACCCATGACACCAAGGACCAGAGCCCCTCACGGGCACCAGGGCTTCGCCAGCGGGCCAGCAACAAAGTGCAAGATTCTGCCCCCGTGGAGACTCCCAGAGGGAAGCCCCCACTCAACACCCGCTCCCAGGCTCCGCTTCTCCGATGGGTCCTTACACTCAGCTTTCTGGTGGCGACAGTTGCTGTAGGGCTTTATGCCATGTGA |
ORF Protein Sequence | MERPQPDSMPQDLSEALKEATKEVHTQAENAEFMRNFQKGQVTRDGFKLVMASLYHIYVALEEEIERNKESPVFAPVYFPEELHRKAALEQDLAFWYGPRWQEVIPYTPAMQRYVKRLHEVGRTEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGLAFFTFPNIASATKFKQLYRSRMNSLEMTPAVRQRVIEEAKTAFLLNIQLFEELQELLTHDTKDQSPSRAPGLRQRASNKVQDSAPVETPRGKPPLNTRSQAPLLRWVLTLSFLVATVAVGLYAM |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0044-Ab | Anti-HMOX1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0044-Ag | HMOX1 protein |
ORF Viral Vector | pGMLP003511 | Human HMOX1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000302 | Human HMOX1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000303 | Human HMOX1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000774 | Human HMOX1 Lentivirus plasmid |
ORF Viral Vector | pGMLV002552 | Human HMOX1 Lentivirus plasmid |
ORF Viral Vector | pGMPC001181 | Human HMOX1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | pGMPC001301 | Human HMOX1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLP003511 | Human HMOX1 Lentivirus particle |
ORF Viral Vector | vGMLV000302 | Human HMOX1 Lentivirus particle |
ORF Viral Vector | vGMLV000303 | Human HMOX1 Lentivirus particle |
ORF Viral Vector | vGMLV000774 | Human HMOX1 Lentivirus particle |
ORF Viral Vector | vGMLV002552 | Human HMOX1 Lentivirus particle |
Target information
Target ID | GM-IP0044 |
Target Name | HMOX1 |
Gene ID | 3162, 15368, 719266, 24451, 101092621, 442987, 513221, 100069058 |
Gene Symbol and Synonyms | bK286B10,D8Wsu38e,Hemox,Heox,HEOXG,Hmox,HMOX1,HMOX1D,HO-1,HO1,HSP32 |
Uniprot Accession | P09601 |
Uniprot Entry Name | HMOX1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Therapeutics Target |
Disease | Acute kidney failure, Renal tubulo-interstitial diseases |
Gene Ensembl | ENSG00000100292 |
Target Classification | Not Available |
Heme oxygenase, an essential enzyme in heme catabolism, cleaves heme to form biliverdin, which is subsequently converted to bilirubin by biliverdin reductase, and carbon monoxide, a putative neurotransmitter. Heme oxygenase activity is induced by its substrate heme and by various nonheme substances. Heme oxygenase occurs as 2 isozymes, an inducible heme oxygenase-1 and a constitutive heme oxygenase-2. HMOX1 and HMOX2 belong to the heme oxygenase family. [provided by RefSeq, Jul 2008]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.