Human STMN1/C1orf215/Lag ORF/cDNA clone-Lentivirus plasmid (NM_001145454.2)
Cat. No.: pGMLV000481
Size: 10 µg
Concentration: generally 0.5ug/ul, usually not less than 0.3ug/ul
Leading Time: 3-7 working days
Pre-made Human STMN1/C1orf215/Lag Lentiviral expression plasmid for STMN1 lentivirus packaging, STMN1 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.
Our GM-Lentiviral vector is seamlessly integrated with the GM lentivirus packaging system. Discover more about the GM lentivirus packaging system.
Go to
STMN1/C1orf215 products
collection>>
(antibodies,
antigen, VLP, mRNA, ORF viral vector, etc)
Product Description
Catalog ID | pGMLV000481 |
Gene Name | STMN1 |
Accession Number | NM_001145454.2 |
Gene ID | 3925 |
Species | Human |
Product Type | Lentivirus plasmid (overexpression) |
Insert Length | 525 bp |
Gene Alias | C1orf215,Lag,LAP18,OP18,PP17,PP19,PR22,SMN |
Fluorescent Reporter | ZsGreen |
Mammalian Cell Selection | Puromyocin |
Fusion Tag | 3xflag (C-Terminal) |
Promoter | CMV |
Resistance | Amplicin |
ORF Nucleotide Sequence | ATGGCTTCTTCTGATATCCAGGTGAAAGAACTGGAGAAGCGTGCCTCAGGCCAGGCTTTTGAGCTGATTCTCAGCCCTCGGTCAAAAGAATCTGTTCCAGAATTCCCCCTTTCCCCTCCAAAGAAGAAGGATCTTTCCCTGGAGGAAATTCAGAAGAAATTAGAAGCTGCAGAAGAAAGACGCAAGTCCCATGAAGCTGAGGTCTTGAAGCAGCTGGCTGAGAAACGAGAGCACGAGAAAGAAGTGCTTCAGAAGGCAATAGAAGAGAACAACAACTTCAGTAAAATGGCAGAAGAGAAACTGACCCACAAAATGGAAGCTAATAAAGAGAACCGAGAGGCACAAATGGCTGCCAAACTGGAACGTTTGCGAGAGAAGATGTACTTCTGGACTCACGGGCCTGGGGCCCACCCAGCACAGATCTCTGCTGAGCAATCTTGTCTCCACTCTGTTCCTGCCCTTTGCCCAGCCCTGGGCCTCCAATCTGCATTGATTACCTGGTCTGATCTCTCTCACCATCACTAG |
ORF Protein Sequence | MASSDIQVKELEKRASGQAFELILSPRSKESVPEFPLSPPKKKDLSLEEIQKKLEAAEERRKSHEAEVLKQLAEKREHEKEVLQKAIEENNNFSKMAEEKLTHKMEANKENREAQMAAKLERLREKMYFWTHGPGAHPAQISAEQSCLHSVPALCPALGLQSALITWSDLSHHH |
Reference
Data / case study
Click to get more Data / Case study about the product.
Associated products
Category | Cat No. | Products Name |
---|---|---|
Target Antibody | GM-Tg-g-IP0228-Ab | Anti-STMN1 monoclonal antibody |
Target Antigen | GM-Tg-g-IP0228-Ag | STMN1 protein |
ORF Viral Vector | pGMLV000379 | Human STMN1 Lentivirus plasmid |
ORF Viral Vector | pGMLV000481 | Human STMN1 Lentivirus plasmid |
ORF Viral Vector | pGMAD000071 | Human STMN1 Adenovirus plasmid |
ORF Viral Vector | pGMAP000293 | Human STMN1 Adenovirus plasmid |
ORF Viral Vector | pGMPC000150 | Human STMN1 Mammalian (Non-Viral Vector) plasmid |
ORF Viral Vector | vGMLV000379 | Human STMN1 Lentivirus particle |
ORF Viral Vector | vGMLV000481 | Human STMN1 Lentivirus particle |
ORF Viral Vector | vGMAD000071 | Human STMN1 Adenovirus particle |
ORF Viral Vector | vGMAP000293 | Human STMN1 Adenovirus particle |
Target information
Target ID | GM-IP0228 |
Target Name | STMN1 |
Gene ID | 3925, 16765, 719733, 29332, 101082582, 478175, 616317, 100057411 |
Gene Symbol and Synonyms | 19k,C1orf215,Lag,LAP18,OP18,P18,P19,Pig,PP17,Pp18,PP19,PR22,prosolin,SMN,STMN1 |
Uniprot Accession | P16949 |
Uniprot Entry Name | STMN1_HUMAN |
Protein Sub-location | Introcelluar Protein |
Category | Not Available |
Disease | Cancer |
Gene Ensembl | ENSG00000117632 |
Target Classification | Tumor-associated antigen (TAA) |
This gene belongs to the stathmin family of genes. It encodes a ubiquitous cytosolic phosphoprotein proposed to function as an intracellular relay integrating regulatory signals of the cellular environment. The encoded protein is involved in the regulation of the microtubule filament system by destabilizing microtubules. It prevents assembly and promotes disassembly of microtubules. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Feb 2009]
About GMVC
GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.