Human MAPK14/EXIP/Mxi2 ORF/cDNA clone-Lentivirus particle (BC000092)

Cat. No.: vGMLP-SPh-131

Pre-made Human MAPK14/EXIP/Mxi2 Lentiviral expression plasmid for MAPK14 lentivirus packaging, MAPK14 lentivirus production, overexpression stable cell line development, cell transient transfection and gene delivery targeting T/B/NK cells, macrophages, cardiomyocytes, hepatocytes, and neurons.

The GM Vector Core (GMVC) specializes in custom lentivirus development and offers a range of lentivirus manufacturing solutions, leveraging state-of-the-art processes. Learn more about our services.

Target products collection

Go to p38 alpha/MAPK14/EXIP products collection>>
(antibodies, antigen, VLP, mRNA, ORF viral vector, etc)

Product information

Catalog No. Product Name lentivirus Grade lentivirus quantity
vGMLP-SPh-131 Human MAPK14 Lentivirus particle Pilot Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
Research Grade 1.0E+8TU
5.0E+8TU
1.0E+9TU
GMP-like Grade inquiry
GMP Grade inquiry


Product Description

Catalog ID vGMLP-SPh-131
Gene Name MAPK14
Accession Number BC000092
Gene ID 1432
Species Human
Product Type Lentivirus particle (overexpression)
Insert Length 1083 bp
Gene Alias EXIP,Mxi2,p38,p38ALPHA,PRKM14,PRKM15,RK,SAPK2A
Fluorescent Reporter ZsGreen
Mammalian Cell Selection Puromyocin
Fusion Tag 3xflag (C-Terminal)
Promoter CMV
Resistance Amplicin
ORF Nucleotide Sequence ATGTCTCAGGAGAGGCCCACGTTCTACCGGCAGGAGCTGAACAAGACAATCTGGGAGGTGCCCGAGCGTTACCAGAACCTGTCTCCAGTGGGCTCTGGCGCCTATGGCTCTGTGTGTGCTGCTTTTGACACAAAAACGGGGTTACGTGTGGCAGTGAAGAAGCTCTCCAGACCATTTCAGTCCATCATTCATGCGAAAAGAACCTACAGAGAACTGCGGTTACTTAAACATATGAAACATGAAAATGTGATTGGTCTGTTGGACGTTTTTACACCTGCAAGGTCTCTGGAGGAATTCAATGATGTGTATCTGGTGACCCATCTCATGGGGGCAGATCTGAACAACATTGTGAAATGTCAGAAGCTTACAGATGACCATGTTCAGTTCCTTATCTACCAAATTCTCCGAGGTCTAAAGTATATACATTCAGCTGACATAATTCACAGGGACCTAAAACCTAGTAATCTAGCTGTGAATGAAGACTGTGAGCTGAAGATTCTGGATTTTGGACTGGCTCGGCACACAGATGATGAAATGACAGGCTACGTGGCCACTAGGTGGTACAGGGCTCCTGAGATCATGCTGAACTGGATGCATTACAACCAGACAGTTGATATTTGGTCAGTGGGATGCATAATGGCCGAGCTGTTGACTGGAAGAACATTGTTTCCTGGTACAGACCATATTGATCAGTTGAAGCTCATTTTAAGACTCGTTGGAACCCCAGGGGCTGAGCTTTTGAAGAAAATCTCCTCAGAGTCTGCAAGAAACTATATTCAGTCTTTGACTCAGATGCCGAAGATGAACTTTGCGAATGTATTTATTGGTGCCAATCCCCTGGCTGTCGACTTGCTGGAGAAGATGCTTGTATTGGACTCAGATAAGAGAATTACAGCGGCCCAAGCCCTTGCACATGCCTACTTTGCTCAGTACCACGATCCTGATGATGAACCAGTGGCCGATCCTTATGATCAGTCCTTTGAAAGCAGGGACCTCCTTATAGATGAGTGGAAAAGCCTGACCTATGATGAAGTCATCAGCTTTGTGCCACCACCCCTTGACCAAGAAGAGATGGAGTCCTGA
ORF Protein Sequence MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQSIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQKLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMTGYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVGTPGAELLKKISSESARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAAQALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES

Reference




    Data / case study


    Click to get more Data / Case study about the product.



    Associated products


    Category Cat No. Products Name
    Target Antibody GM-Tg-g-T65864-Ab Anti-p38 alpha monoclonal antibody
    Target Antigen GM-Tg-g-T65864-Ag p38 alpha/MAPK14 protein
    ORF Viral Vector pGMLP005331 Human MAPK14 Lentivirus plasmid
    ORF Viral Vector pGMLP005805 Human MAPK14 Lentivirus plasmid
    ORF Viral Vector pGMAD000565 Human MAPK14 Adenovirus plasmid
    ORF Viral Vector pGMAP000408 Human MAPK14 Adenovirus plasmid
    ORF Viral Vector pGMLP-SPh-057 Human MAPK14 Lentivirus plasmid
    ORF Viral Vector pGMLP-SPh-131 Human MAPK14 Lentivirus plasmid
    ORF Viral Vector pGMAP-SPh-197 Human MAPK14 Adenovirus plasmid
    ORF Viral Vector pGMAP-SPh-271 Human MAPK14 Adenovirus plasmid
    ORF Viral Vector pGMPC000541 Human MAPK14 Mammalian (Non-Viral Vector) plasmid
    ORF Viral Vector vGMLP005331 Human MAPK14 Lentivirus particle
    ORF Viral Vector vGMLP005805 Human MAPK14 Lentivirus particle
    ORF Viral Vector vGMAD000565 Human MAPK14 Adenovirus particle
    ORF Viral Vector vGMAP000408 Human MAPK14 Adenovirus particle
    ORF Viral Vector vGMLP-SPh-057 Human MAPK14 Lentivirus particle
    ORF Viral Vector vGMLP-SPh-131 Human MAPK14 Lentivirus particle
    ORF Viral Vector vGMAP-SPh-197 Human MAPK14 Adenovirus particle
    ORF Viral Vector vGMAP-SPh-271 Human MAPK14 Adenovirus particle


    Target information

    Target ID GM-T65864
    Target Name p38 alpha
    Gene ID 1432, 26416, 718976, 81649, 101101135, 403856, 534492, 100063532
    Gene Symbol and Synonyms Crk1,CSBP,CSBP1,CSBP2,CSPB1,EXIP,Hog,MAPK14,Mxi2,p38,p38-alpha,p38a,p38ALPHA,p38Hog,p38MAPK,PRKM14,PRKM15,RK,SAPK2A
    Uniprot Accession Q16539
    Uniprot Entry Name MK14_HUMAN
    Protein Sub-location Introcelluar Protein
    Category Therapeutics Target, Immuno-oncology Target
    Disease Breast Cancer
    Gene Ensembl ENSG00000112062
    Target Classification Checkpoint-Immuno Oncology, Kinase

    The protein encoded by this gene is a member of the MAP kinase family. MAP kinases act as an integration point for multiple biochemical signals, and are involved in a wide variety of cellular processes such as proliferation, differentiation, transcription regulation and development. This kinase is activated by various environmental stresses and proinflammatory cytokines. The activation requires its phosphorylation by MAP kinase kinases (MKKs), or its autophosphorylation triggered by the interaction of MAP3K7IP1/TAB1 protein with this kinase. The substrates of this kinase include transcription regulator ATF2, MEF2C, and MAX, cell cycle regulator CDC25B, and tumor suppressor p53, which suggest the roles of this kinase in stress related transcription and cell cycle regulation, as well as in genotoxic stress response. Four alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Jul 2008]



    About GMVC

    GDU

    GMVC (GM Vector Core) is GeneMedi’s unique platform for QbD Viral vectors Processes development and manufacturing. In GMVC, our core expertise lies in the tailored production of viral vectors, including adeno-associated virus (AAV), lentivirus, and adenovirus. Our state-of-the-art facilities are equipped for scalable manufacturing, ensuring high-quality viral vector production to meet both research and therapeutic needs. Our expert team specializes in process development, leveraging innovative technology and extensive industry knowledge to provide clients with tailored solutions that exceed expectations. GMVC will be the ideal partner for scientists and healthcare professionals seeking reliable and efficient viral vector production services.